BLASTX nr result
ID: Ophiopogon23_contig00035712
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00035712 (534 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271718.1| pentatricopeptide repeat-containing protein ... 150 2e-40 ref|XP_010909909.2| PREDICTED: pentatricopeptide repeat-containi... 103 7e-23 ref|XP_008797418.1| PREDICTED: pentatricopeptide repeat-containi... 101 5e-22 gb|PIA58415.1| hypothetical protein AQUCO_00500382v1 [Aquilegia ... 100 7e-22 ref|XP_020685754.1| pentatricopeptide repeat-containing protein ... 99 3e-21 ref|XP_010241042.1| PREDICTED: pentatricopeptide repeat-containi... 98 8e-21 ref|XP_020597633.1| pentatricopeptide repeat-containing protein ... 98 1e-20 ref|XP_020081785.1| pentatricopeptide repeat-containing protein ... 92 3e-20 gb|PIA58413.1| hypothetical protein AQUCO_00500380v1 [Aquilegia ... 96 6e-20 ref|XP_020703898.1| pentatricopeptide repeat-containing protein ... 95 1e-19 gb|PKU70278.1| Pentatricopeptide repeat-containing protein [Dend... 95 1e-19 ref|XP_020591825.1| pentatricopeptide repeat-containing protein ... 92 1e-18 ref|XP_020091639.1| pentatricopeptide repeat-containing protein ... 92 1e-18 ref|XP_020258347.1| pentatricopeptide repeat-containing protein ... 92 1e-18 gb|OAY63633.1| Pentatricopeptide repeat-containing protein, mito... 91 3e-18 gb|PAN28098.1| hypothetical protein PAHAL_E01357 [Panicum hallii] 91 4e-18 ref|XP_023876721.1| pentatricopeptide repeat-containing protein ... 90 8e-18 gb|OVA15362.1| Pentatricopeptide repeat [Macleaya cordata] 88 3e-17 ref|XP_009630488.1| PREDICTED: pentatricopeptide repeat-containi... 87 5e-17 ref|XP_009420600.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-17 >ref|XP_020271718.1| pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Asparagus officinalis] gb|ONK79077.1| uncharacterized protein A4U43_C01F2660 [Asparagus officinalis] Length = 393 Score = 150 bits (378), Expect = 2e-40 Identities = 73/115 (63%), Positives = 88/115 (76%), Gaps = 3/115 (2%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +L+KGYC+ G LEEAK+VYLRL C PD+ TF+ML+ W AK++DF RLCNE++N Sbjct: 279 ALMKGYCECGMLEEAKRVYLRLGGNGCRPDLWTFKMLVVEFWVAKEFDFAARLCNESINY 338 Query: 183 GCYLDVEMLQGVV---DGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMPLPCLAM 338 GCYL VE LQ VV DGLAKEEM +AKKLVK ARS+SFYGSKCL+MPL C + Sbjct: 339 GCYLSVETLQAVVDGXDGLAKEEMLLRAKKLVKLARSRSFYGSKCLKMPLSCFVV 393 >ref|XP_010909909.2| PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial [Elaeis guineensis] Length = 392 Score = 103 bits (257), Expect = 7e-23 Identities = 53/107 (49%), Positives = 73/107 (68%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +LIK YCQDG L+ AK++YL L + C P+ TF+ LIP++ EA D D ++ CN++M+ Sbjct: 285 ALIKRYCQDGNLKMAKRLYLDLTKNDCAPNRGTFETLIPSLCEAGDLDLALKCCNDSMSH 344 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMPL 323 C +D +LQ VVDGL K ++AKKLVK R ++FY K LRMPL Sbjct: 345 RCVVDASVLQEVVDGLVKLSRVEEAKKLVKLGR-RNFYSRKDLRMPL 390 >ref|XP_008797418.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Phoenix dactylifera] ref|XP_008797419.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Phoenix dactylifera] ref|XP_008797420.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Phoenix dactylifera] ref|XP_008797421.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Phoenix dactylifera] Length = 389 Score = 101 bits (251), Expect = 5e-22 Identities = 52/108 (48%), Positives = 72/108 (66%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +LIKG+CQDG LEEAK++YL L C + TF+ LIP++ EA D D ++ CNE+M+ Sbjct: 282 ALIKGHCQDGNLEEAKRLYLDLTNNGCASNRGTFETLIPSLCEAGDLDLALKCCNESMSR 341 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMPLP 326 C +D MLQ VV+GL K ++AKKLV+ R +++Y K L MP P Sbjct: 342 RCVVDASMLQEVVEGLVKLSRVEEAKKLVELGR-RNYYSRKDLGMPSP 388 >gb|PIA58415.1| hypothetical protein AQUCO_00500382v1 [Aquilegia coerulea] Length = 394 Score = 100 bits (250), Expect = 7e-22 Identities = 50/105 (47%), Positives = 70/105 (66%) Frame = +3 Query: 6 LIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNVG 185 LI+GYC DG +EAK VY +L+ C P+ TF+ LIP ++E D D ++LC +++N Sbjct: 287 LIEGYCNDGYSDEAKSVYDHMLKSGCIPNRTTFETLIPYIYEKGDLDLALKLCLDSVNSN 346 Query: 186 CYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMP 320 C +DV +LQ VVDG AK K+A+ VK ARSK ++ SK L+MP Sbjct: 347 CLIDVGVLQVVVDGFAKASRIKEAENFVKLARSKKYHDSK-LKMP 390 >ref|XP_020685754.1| pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Dendrobium catenatum] gb|PKU59986.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 409 Score = 99.4 bits (246), Expect = 3e-21 Identities = 51/112 (45%), Positives = 75/112 (66%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +LIK YCQDG LE+AK VY+ L+ C P+ TF +LIP++ EA + D +++ E+++ Sbjct: 299 ALIKAYCQDGNLEQAKLVYMNLINNGCAPNKETFLVLIPSLSEAGELDLALKVSKESLSR 358 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMPLPCLAM 338 C E+LQ VVDGLAK ++A+KLV+ +R+ Y K +RMPL CLA+ Sbjct: 359 RCSPGSEILQRVVDGLAKNFKVEEARKLVEISRANG-YSKKSIRMPLSCLAV 409 >ref|XP_010241042.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Nelumbo nucifera] Length = 380 Score = 97.8 bits (242), Expect = 8e-21 Identities = 49/107 (45%), Positives = 70/107 (65%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +LIKG+C +G LEEAKK+Y L + C P+ T++ L+P + E +D+ +LC E++N Sbjct: 276 ALIKGFCNEGNLEEAKKIYSELEKNDCTPNRPTYETLVPCLCEKEDFGLAFKLCKESLN- 334 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMPL 323 C +D +LQ VVDGL KE + AKKLV+ RSKS Y L+MP+ Sbjct: 335 RCRVDAGLLQVVVDGLVKESKVEDAKKLVELGRSKS-YSRSSLKMPV 380 >ref|XP_020597633.1| pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Phalaenopsis equestris] Length = 401 Score = 97.8 bits (242), Expect = 1e-20 Identities = 49/112 (43%), Positives = 73/112 (65%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 + IK YCQ G LE+AK +Y+ L++ C P+ TF +LIP++ EA + D +RL E+++ Sbjct: 291 AFIKSYCQVGNLEQAKLIYMDLIKNDCAPNKETFTVLIPSLCEAGELDLALRLSKESLSR 350 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMPLPCLAM 338 C E+LQG+VDGLAK +AKKLV+ +R+ Y K +R+P CLA+ Sbjct: 351 RCSPGSEILQGLVDGLAKNSKLGEAKKLVEISRANG-YSGKSIRLPFSCLAV 401 >ref|XP_020081785.1| pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Ananas comosus] Length = 160 Score = 91.7 bits (226), Expect = 3e-20 Identities = 46/106 (43%), Positives = 69/106 (65%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 ++I+G+C+ G LE AK VYL L++ C P+ TF+ LIP + EA D+D +R C ++M+ Sbjct: 50 AVIRGHCKIGNLEAAKTVYLDLVKNGCAPNKGTFEALIPHLCEAGDFDLALRCCYDSMSR 109 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMP 320 C+ D +LQ VVDGL ++A+KLV+ AR+ Y K L+MP Sbjct: 110 KCFADAAVLQKVVDGLVAASRAEEAEKLVERARTNK-YSKKSLKMP 154 >gb|PIA58413.1| hypothetical protein AQUCO_00500380v1 [Aquilegia coerulea] Length = 386 Score = 95.5 bits (236), Expect = 6e-20 Identities = 47/105 (44%), Positives = 69/105 (65%) Frame = +3 Query: 6 LIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNVG 185 LIK YC DG+ ++AK+VY LL + + T++ LIP + E D+DF ++LC +++ + Sbjct: 279 LIKSYCNDGKYDDAKRVYDELLADGHKENRWTYEALIPVLCEKGDFDFALKLCKKSLGLN 338 Query: 186 CYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMP 320 CYL +LQ VVDGL K+ A +LV+ ARSKS YG K L++P Sbjct: 339 CYLSAGILQVVVDGLVKQSKVNDANELVELARSKS-YGRKSLKLP 382 >ref|XP_020703898.1| pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Dendrobium catenatum] Length = 408 Score = 95.1 bits (235), Expect = 1e-19 Identities = 49/112 (43%), Positives = 76/112 (67%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +LIKGYC+ G LEEAK+++ ++ ++ C PD T + LIP + + D + +C +A+ Sbjct: 299 ALIKGYCRQGNLEEAKRIHKQMGKKGCFPDRHTLRELIPKLCGGGEVDLALNICIKAIEN 358 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMPLPCLAM 338 G +DV ++Q ++D LAK ++ KAKKLVK A+SK+ + LRMPLPCLA+ Sbjct: 359 GFVVDVGIVQVMIDELAKGSLYDKAKKLVKLAKSKNNRAN--LRMPLPCLAL 408 >gb|PKU70278.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 433 Score = 95.1 bits (235), Expect = 1e-19 Identities = 49/112 (43%), Positives = 76/112 (67%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +LIKGYC+ G LEEAK+++ ++ ++ C PD T + LIP + + D + +C +A+ Sbjct: 324 ALIKGYCRQGNLEEAKRIHKQMGKKGCFPDRHTLRELIPKLCGGGEVDLALNICIKAIEN 383 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMPLPCLAM 338 G +DV ++Q ++D LAK ++ KAKKLVK A+SK+ + LRMPLPCLA+ Sbjct: 384 GFVVDVGIVQVMIDELAKGSLYDKAKKLVKLAKSKNNRAN--LRMPLPCLAL 433 >ref|XP_020591825.1| pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Phalaenopsis equestris] ref|XP_020591826.1| pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Phalaenopsis equestris] Length = 397 Score = 92.0 bits (227), Expect = 1e-18 Identities = 48/112 (42%), Positives = 73/112 (65%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +LIKGYC+ G LEEAK++Y ++ + C PD T + LIP + + D D + +C +A++ Sbjct: 288 ALIKGYCRQGNLEEAKRLYKQMGKNGCFPDRHTLRELIPKLCQGGDVDLALNICIKAIDN 347 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMPLPCLAM 338 G +DV ++Q ++D L K + KAKKLVK AR K+ + L+MPL CLA+ Sbjct: 348 GFLVDVGIIQVLIDELVKGSLHDKAKKLVKRARLKNDRAN--LKMPLSCLAI 397 >ref|XP_020091639.1| pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like, partial [Ananas comosus] Length = 366 Score = 91.7 bits (226), Expect = 1e-18 Identities = 46/106 (43%), Positives = 69/106 (65%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 ++I+G+C+ G LE AK VYL L++ C P+ TF+ LIP + EA D+D +R C ++M+ Sbjct: 256 AVIRGHCKIGNLEAAKTVYLDLVKNGCAPNKGTFEALIPHLCEAGDFDLALRCCYDSMSR 315 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMP 320 C+ D +LQ VVDGL ++A+KLV+ AR+ Y K L+MP Sbjct: 316 KCFADAAVLQKVVDGLVAASRAEEAEKLVERARTNK-YSKKSLKMP 360 >ref|XP_020258347.1| pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Asparagus officinalis] gb|ONK74685.1| uncharacterized protein A4U43_C03F9090 [Asparagus officinalis] Length = 371 Score = 91.7 bits (226), Expect = 1e-18 Identities = 47/106 (44%), Positives = 67/106 (63%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +LIK +C+DG LEEAKK+Y+ L + C P TF +LIP++ + + D ++LCNE M+ Sbjct: 267 TLIKAFCKDGNLEEAKKIYVNLTKNDCAPSRGTFDVLIPSLCKTGELDTALKLCNENMSR 326 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMP 320 +D +LQ V++GL K +KAKKLV AR Y K +RMP Sbjct: 327 RRLVDAPILQEVINGLVKGSSMEKAKKLVDLARQNG-YSKKNVRMP 371 >gb|OAY63633.1| Pentatricopeptide repeat-containing protein, mitochondrial [Ananas comosus] Length = 417 Score = 91.3 bits (225), Expect = 3e-18 Identities = 46/106 (43%), Positives = 70/106 (66%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 ++I+G+C+ G LE AK VYL L++ C P+ TF+ LIP + EA D+D +R C ++M+ Sbjct: 307 AVIRGHCKIGNLEAAKTVYLDLVKNGCAPNKGTFEALIPHLCEAGDFDLALRCCYDSMSR 366 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMP 320 C+ D +LQ VVDGL ++A+KL++ AR K+ Y K L+MP Sbjct: 367 KCFADAAVLQKVVDGLVAASRAEEAEKLLERAR-KNKYSKKSLKMP 411 >gb|PAN28098.1| hypothetical protein PAHAL_E01357 [Panicum hallii] Length = 458 Score = 90.9 bits (224), Expect = 4e-18 Identities = 46/105 (43%), Positives = 68/105 (64%) Frame = +3 Query: 6 LIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNVG 185 LI+GYC +GRL+EAKKVY L++ +C P+ TF L+P + EA + D +R C+E ++ Sbjct: 310 LIRGYCNEGRLDEAKKVYDDLVKNECAPNRGTFHTLVPRLLEAGELDSALRCCDEILSRK 369 Query: 186 CYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMP 320 C + +LQGVV L ++AK++V+ R K+FY K LRMP Sbjct: 370 CKVQCSLLQGVVTALVAASRVEEAKRIVELGR-KNFYPRKGLRMP 413 >ref|XP_023876721.1| pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Quercus suber] gb|POF23343.1| pentatricopeptide repeat-containing protein, mitochondrial [Quercus suber] Length = 387 Score = 89.7 bits (221), Expect = 8e-18 Identities = 45/107 (42%), Positives = 68/107 (63%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +LIKG+C+DG+L+EAK Y + + C+PD VT+ LIP + E D+D LC E + Sbjct: 280 ALIKGFCKDGKLDEAKWWYNEIRKNDCSPDWVTYMTLIPCLCEEGDFDMAHELCVEVIKQ 339 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMPL 323 +D+ +L+ VVDGL KE +KAK+LV+ +S ++ K L +PL Sbjct: 340 RLRIDIALLRRVVDGLVKETEIEKAKELVELGKSNKYFHFK-LELPL 385 >gb|OVA15362.1| Pentatricopeptide repeat [Macleaya cordata] Length = 393 Score = 88.2 bits (217), Expect = 3e-17 Identities = 43/105 (40%), Positives = 67/105 (63%) Frame = +3 Query: 6 LIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNVG 185 LI G+C DG LEEAK++Y LL + P+ T + L+P++ +++ ++LC + +N Sbjct: 284 LIAGFCNDGNLEEAKRIYNELLRNEWVPNRSTIETLVPSLCGNGEFELALKLCMDGLNRR 343 Query: 186 CYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMP 320 C++D +LQ VVDGL KE ++AKKLV+ R K+ Y L+MP Sbjct: 344 CFVDSGLLQAVVDGLVKESKIEEAKKLVELGRLKN-YSRSNLKMP 387 >ref|XP_009630488.1| PREDICTED: pentatricopeptide repeat-containing protein At3g13160, mitochondrial-like [Nicotiana tomentosiformis] Length = 380 Score = 87.4 bits (215), Expect = 5e-17 Identities = 43/106 (40%), Positives = 66/106 (62%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +LI+GYC G LEEAKK YL L++ +P+ V F +I A E D+D+ LC + Sbjct: 273 TLIRGYCDKGNLEEAKKWYLELVKSGSSPNKVIFGSVITAACEKGDFDWAFELCKDVFKN 332 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMP 320 C++D E+LQGVVDG+ K +AK++V+ +S ++ K L++P Sbjct: 333 KCHVDAELLQGVVDGMVKSSRIWEAKEVVRLGKSNDYHLYK-LKLP 377 >ref|XP_009420600.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55890, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 401 Score = 87.4 bits (215), Expect = 6e-17 Identities = 44/112 (39%), Positives = 71/112 (63%) Frame = +3 Query: 3 SLIKGYCQDGRLEEAKKVYLRLLEEKCNPDMVTFQMLIPAVWEAKDYDFTVRLCNEAMNV 182 +LIKGY Q+G LEEAK+++ + +C P+ TF+++IP + EA + D ++ C ++MN Sbjct: 289 ALIKGYFQEGNLEEAKRLFSDFAKNQCAPNKGTFEIIIPYLCEAGELDLALKCCYDSMNT 348 Query: 183 GCYLDVEMLQGVVDGLAKEEMFKKAKKLVKHARSKSFYGSKCLRMPLPCLAM 338 C+++ + Q VV+GLAK +A KLV R K+ Y K LR+P L++ Sbjct: 349 RCFVEAAVFQRVVNGLAKSSRMDEATKLVDVGR-KNNYSRKSLRIPSANLSL 399