BLASTX nr result
ID: Ophiopogon23_contig00035522
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00035522 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020275957.1| TPR repeat-containing thioredoxin TTL1-like ... 116 1e-27 ref|XP_010269225.1| PREDICTED: TPR repeat-containing thioredoxin... 92 4e-19 ref|XP_023535732.1| TPR repeat-containing thioredoxin TTL1-like ... 89 3e-18 ref|XP_017244786.1| PREDICTED: TPR repeat-containing thioredoxin... 89 3e-18 ref|XP_006852999.1| inactive TPR repeat-containing thioredoxin T... 89 4e-18 ref|XP_019459661.1| PREDICTED: TPR repeat-containing thioredoxin... 86 4e-18 ref|XP_022131623.1| TPR repeat-containing thioredoxin TTL1 [Momo... 89 5e-18 ref|XP_003544787.1| PREDICTED: TPR repeat-containing thioredoxin... 88 1e-17 ref|XP_010261271.1| PREDICTED: TPR repeat-containing thioredoxin... 87 1e-17 ref|XP_021603435.1| TPR repeat-containing thioredoxin TTL1-like ... 87 2e-17 ref|XP_021817316.1| TPR repeat-containing thioredoxin TTL1-like ... 81 2e-17 ref|XP_022975917.1| TPR repeat-containing thioredoxin TTL1-like ... 87 2e-17 ref|XP_019459081.1| PREDICTED: inactive TPR repeat-containing th... 86 3e-17 gb|OIW02389.1| hypothetical protein TanjilG_04982 [Lupinus angus... 86 3e-17 emb|CBI40996.3| unnamed protein product, partial [Vitis vinifera] 86 5e-17 ref|XP_003635218.2| PREDICTED: TPR repeat-containing thioredoxin... 86 5e-17 ref|XP_004500618.1| PREDICTED: inactive TPR repeat-containing th... 86 6e-17 gb|OMO94291.1| Tetratricopeptide-like helical [Corchorus olitorius] 85 1e-16 ref|XP_022937381.1| TPR repeat-containing thioredoxin TTL1-like ... 84 2e-16 emb|CBI19146.3| unnamed protein product, partial [Vitis vinifera] 84 2e-16 >ref|XP_020275957.1| TPR repeat-containing thioredoxin TTL1-like [Asparagus officinalis] ref|XP_020275958.1| TPR repeat-containing thioredoxin TTL1-like [Asparagus officinalis] Length = 666 Score = 116 bits (290), Expect = 1e-27 Identities = 57/90 (63%), Positives = 70/90 (77%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 +MLPG+ VALFFNKSSE S LF M+ ++F SVKFLKVD+E+ P +A+SE IS P Sbjct: 577 IMLPGIYVALFFNKSSEASENLFPSMEGTLKKFTSVKFLKVDIEECPSLAKSENISTTPA 636 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+Y+NGS+VKDIAGS+F QLE IKSF T Sbjct: 637 FKIYKNGSNVKDIAGSDFNQLEHYIKSFET 666 >ref|XP_010269225.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Nelumbo nucifera] Length = 721 Score = 91.7 bits (226), Expect = 4e-19 Identities = 47/89 (52%), Positives = 61/89 (68%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+ V LF NKSS+ A F M Q +++PSV FLKV+VE P + +SE +S VP Sbjct: 634 VTSPGMSVVLFCNKSSDKPA--FEFMQQLCKRYPSVNFLKVEVEDHPYLKKSEGVSAVPS 691 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFS 92 FK+Y+NGS VKDI G+ E LE+CIK +S Sbjct: 692 FKIYKNGSRVKDIPGNNLELLENCIKFYS 720 >ref|XP_023535732.1| TPR repeat-containing thioredoxin TTL1-like [Cucurbita pepo subsp. pepo] Length = 664 Score = 89.4 bits (220), Expect = 3e-18 Identities = 43/90 (47%), Positives = 63/90 (70%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+CVALF NK ++ Q +++QA+++FPSV FLKV++E P +A+ E++S +P Sbjct: 577 VTSPGMCVALFCNKGNQK--QGLEVLEQAYKRFPSVNFLKVEIEDHPYLAKLEKVSAIPA 634 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+YRNG VK+IA SE LE +K S+ Sbjct: 635 FKIYRNGRIVKEIAASESHSLESLVKMCSS 664 >ref|XP_017244786.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Daucus carota subsp. sativus] gb|KZM99907.1| hypothetical protein DCAR_012731 [Daucus carota subsp. sativus] Length = 703 Score = 89.4 bits (220), Expect = 3e-18 Identities = 41/89 (46%), Positives = 62/89 (69%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V+ PG+ V LF NKSS +LF +M+Q +FPS+ FLKV++E P + + E+++ VP Sbjct: 612 VIAPGMSVVLFCNKSSHV--KLFQLMEQVCLRFPSINFLKVEIEDNPYIMQLEDVNSVPA 669 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFS 92 FK+Y+NGS++K+I+G FE LE +K S Sbjct: 670 FKIYKNGSTIKEISGENFESLESSVKMIS 698 >ref|XP_006852999.1| inactive TPR repeat-containing thioredoxin TTL3 [Amborella trichopoda] gb|ERN14466.1| hypothetical protein AMTR_s00174p00014780 [Amborella trichopoda] Length = 703 Score = 89.0 bits (219), Expect = 4e-18 Identities = 44/87 (50%), Positives = 60/87 (68%) Frame = -3 Query: 349 PGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPGFKM 170 PG+ V LF S+ET QL ++Q +++PSV FLKVD E+ P +++SE +S VP FK+ Sbjct: 617 PGMSVGLFCTNSNETCQQLLPFIEQLCKKYPSVNFLKVDTEENPNISKSEGVSSVPAFKI 676 Query: 169 YRNGSSVKDIAGSEFEQLEDCIKSFST 89 Y+NGS VKDIAGS + LE IK S+ Sbjct: 677 YKNGSQVKDIAGSNPQLLESSIKYHSS 703 >ref|XP_019459661.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Lupinus angustifolius] Length = 245 Score = 86.3 bits (212), Expect = 4e-18 Identities = 42/90 (46%), Positives = 64/90 (71%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V LPG+ V LF NK ET+ Q+ ++++ ++FPSV FLKV++E P +A+SE +S VP Sbjct: 158 VTLPGMAVVLFTNK--ETNKQVLLMLEKTSKRFPSVNFLKVEIEDHPFLAKSEGVSSVPA 215 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+Y+NGS V++I+G E LE +K +S+ Sbjct: 216 FKIYKNGSRVEEISGKNHELLERSVKLYSS 245 >ref|XP_022131623.1| TPR repeat-containing thioredoxin TTL1 [Momordica charantia] Length = 682 Score = 88.6 bits (218), Expect = 5e-18 Identities = 41/90 (45%), Positives = 60/90 (66%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+ V LF NKSS + +Q +++FPSV FLKV++E P +A+ E +S +PG Sbjct: 593 VTSPGMSVVLFCNKSSHKQGLELEVFEQVYKRFPSVNFLKVEIEDHPYLAKLENVSSIPG 652 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+YRNG+ VK+I GS+ LE +K +S+ Sbjct: 653 FKIYRNGTVVKEIPGSKPHSLESLVKLYSS 682 >ref|XP_003544787.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Glycine max] gb|KHN21832.1| TPR repeat-containing thioredoxin TTL1 [Glycine soja] gb|KRH16702.1| hypothetical protein GLYMA_14G171800 [Glycine max] Length = 694 Score = 87.8 bits (216), Expect = 1e-17 Identities = 42/90 (46%), Positives = 65/90 (72%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+ VALF NK+ T ++ +++Q ++FPSV FLKV++E P +A+SE +S +P Sbjct: 607 VTSPGMAVALFTNKA--THKKVLLVLEQISKRFPSVNFLKVEIEDHPYLAKSESVSSIPA 664 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+Y+NGSSVK+I+G+ E LE +K +S+ Sbjct: 665 FKIYKNGSSVKEISGNNHELLERSVKLYSS 694 >ref|XP_010261271.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Nelumbo nucifera] Length = 728 Score = 87.4 bits (215), Expect = 1e-17 Identities = 44/90 (48%), Positives = 61/90 (67%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+ V LF NKSS+ Q F+ M Q +++PSV FLKV+VE P + ++E +S VP Sbjct: 641 VTSPGMSVVLFCNKSSDN--QTFNFMQQLCKKYPSVNFLKVEVEDHPYLTKTEGVSAVPS 698 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+Y+NGS VKDI G+ E LE +K +S+ Sbjct: 699 FKIYKNGSRVKDIPGNNHELLESSVKFYSS 728 >ref|XP_021603435.1| TPR repeat-containing thioredoxin TTL1-like [Manihot esculenta] gb|OAY58151.1| hypothetical protein MANES_02G153700 [Manihot esculenta] Length = 714 Score = 87.0 bits (214), Expect = 2e-17 Identities = 42/90 (46%), Positives = 63/90 (70%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+ V LF NK + T Q+ +M+Q ++FPSV FLKV+VE +P +A+SE ++ +P Sbjct: 627 VTSPGMSVVLFCNKENHT--QVLQLMEQVCKRFPSVNFLKVEVEDYPYLAKSESVTSLPS 684 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+Y+NGS VK+I G+ E LE +K +S+ Sbjct: 685 FKIYKNGSRVKEIPGNNRELLEKSVKLYSS 714 >ref|XP_021817316.1| TPR repeat-containing thioredoxin TTL1-like [Prunus avium] Length = 107 Score = 80.9 bits (198), Expect = 2e-17 Identities = 40/90 (44%), Positives = 59/90 (65%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+ V LF +K+ + Q+ + Q +FPSV FLKV+VE P +A+ E++S +P Sbjct: 20 VTSPGMSVVLFCSKTKQK--QVLQALHQVCTRFPSVNFLKVEVEDHPYLAKMEDVSTIPA 77 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+Y+NGS VK+I GS E LE +K +S+ Sbjct: 78 FKIYKNGSRVKEIPGSNHELLESSVKLYSS 107 >ref|XP_022975917.1| TPR repeat-containing thioredoxin TTL1-like [Cucurbita maxima] Length = 663 Score = 86.7 bits (213), Expect = 2e-17 Identities = 42/90 (46%), Positives = 62/90 (68%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+CVALF NK ++ Q +++Q +++FPSV FLKV++E P +A+ E++S +P Sbjct: 576 VTSPGMCVALFCNKGNQK--QGLEVLEQVYKRFPSVNFLKVEIEDHPYLAKLEKVSAIPA 633 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+YRNG VK+IA SE LE +K S+ Sbjct: 634 FKIYRNGRIVKEIAASEPHSLESLVKLCSS 663 >ref|XP_019459081.1| PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like [Lupinus angustifolius] Length = 681 Score = 86.3 bits (212), Expect = 3e-17 Identities = 42/90 (46%), Positives = 64/90 (71%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V LPG+ V LF NK ET+ Q+ ++++ ++FPSV FLKV++E P +A+SE +S VP Sbjct: 594 VTLPGMAVVLFTNK--ETNKQVLLMLEKTSKRFPSVNFLKVEIEDHPFLAKSEGVSSVPA 651 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+Y+NGS V++I+G E LE +K +S+ Sbjct: 652 FKIYKNGSRVEEISGKNHELLERSVKLYSS 681 >gb|OIW02389.1| hypothetical protein TanjilG_04982 [Lupinus angustifolius] Length = 941 Score = 86.3 bits (212), Expect = 3e-17 Identities = 42/90 (46%), Positives = 64/90 (71%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V LPG+ V LF NK ET+ Q+ ++++ ++FPSV FLKV++E P +A+SE +S VP Sbjct: 854 VTLPGMAVVLFTNK--ETNKQVLLMLEKTSKRFPSVNFLKVEIEDHPFLAKSEGVSSVPA 911 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+Y+NGS V++I+G E LE +K +S+ Sbjct: 912 FKIYKNGSRVEEISGKNHELLERSVKLYSS 941 Score = 85.5 bits (210), Expect = 7e-17 Identities = 42/88 (47%), Positives = 62/88 (70%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V LPG+ V LF NK ET+ Q+ ++++ ++FPSV FLKV++E P +A+SE +S VP Sbjct: 594 VTLPGMAVVLFTNK--ETNKQVLLMLEKTSKRFPSVNFLKVEIEDHPFLAKSEGVSSVPA 651 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSF 95 FK+Y+NGS V++I+G E LE +K F Sbjct: 652 FKIYKNGSRVEEISGKNHELLERSVKLF 679 >emb|CBI40996.3| unnamed protein product, partial [Vitis vinifera] Length = 701 Score = 85.9 bits (211), Expect = 5e-17 Identities = 42/87 (48%), Positives = 61/87 (70%) Frame = -3 Query: 349 PGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPGFKM 170 PG+ VALF S E S Q+ M+Q +++PSV FLKV+VE+ P +A SE +S +P FK+ Sbjct: 617 PGVSVALFC--SGEGSKQVIQFMEQLCKRYPSVNFLKVEVEEHPNIARSEGVSSLPAFKI 674 Query: 169 YRNGSSVKDIAGSEFEQLEDCIKSFST 89 Y+NGS VK+I+G + LE +KS++T Sbjct: 675 YKNGSRVKEISGDNLDLLESTVKSYNT 701 >ref|XP_003635218.2| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Vitis vinifera] Length = 713 Score = 85.9 bits (211), Expect = 5e-17 Identities = 42/87 (48%), Positives = 61/87 (70%) Frame = -3 Query: 349 PGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPGFKM 170 PG+ VALF S E S Q+ M+Q +++PSV FLKV+VE+ P +A SE +S +P FK+ Sbjct: 629 PGVSVALFC--SGEGSKQVIQFMEQLCKRYPSVNFLKVEVEEHPNIARSEGVSSLPAFKI 686 Query: 169 YRNGSSVKDIAGSEFEQLEDCIKSFST 89 Y+NGS VK+I+G + LE +KS++T Sbjct: 687 YKNGSRVKEISGDNLDLLESTVKSYNT 713 >ref|XP_004500618.1| PREDICTED: inactive TPR repeat-containing thioredoxin TTL3 [Cicer arietinum] Length = 650 Score = 85.5 bits (210), Expect = 6e-17 Identities = 42/90 (46%), Positives = 62/90 (68%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+ V LF NK+ T Q+ +++Q ++FPSV FLKV++E P +A+SE ++ VP Sbjct: 563 VTSPGMSVVLFCNKA--THKQVLLVLEQTCKRFPSVNFLKVEIEDHPYMAKSEGVNSVPA 620 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+Y+NGS VK+I G+ E LE +K FS+ Sbjct: 621 FKIYKNGSRVKEIPGNNHEMLERSVKLFSS 650 >gb|OMO94291.1| Tetratricopeptide-like helical [Corchorus olitorius] Length = 686 Score = 84.7 bits (208), Expect = 1e-16 Identities = 41/90 (45%), Positives = 62/90 (68%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+ V LF NK++ Q+ +M+Q ++FPSV FLKV+VE P +A+SE +S +P Sbjct: 599 VTSPGMTVVLFCNKANHK--QVLQLMEQVCKRFPSVNFLKVEVEDHPYLAKSEAVSSIPA 656 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+Y+NGS VK++ G+ E LE +K +S+ Sbjct: 657 FKIYKNGSRVKEVPGNNAELLERSVKLYSS 686 >ref|XP_022937381.1| TPR repeat-containing thioredoxin TTL1-like [Cucurbita moschata] Length = 663 Score = 84.3 bits (207), Expect = 2e-16 Identities = 41/90 (45%), Positives = 61/90 (67%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+CVALF NK ++ Q +++Q +++FPSV FLKV++E P +A+ E++S +P Sbjct: 576 VTSPGMCVALFCNKGNQK--QGLEVLEQVYKRFPSVNFLKVEIEDHPYLAKLEKVSAIPA 633 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+YRNG VK+IA S LE +K S+ Sbjct: 634 FKIYRNGRIVKEIAASGPHSLESLVKMCSS 663 >emb|CBI19146.3| unnamed protein product, partial [Vitis vinifera] Length = 685 Score = 84.3 bits (207), Expect = 2e-16 Identities = 42/90 (46%), Positives = 62/90 (68%) Frame = -3 Query: 358 VMLPGLCVALFFNKSSETSAQLFSIMDQAFEQFPSVKFLKVDVEQFPCVAESEEISRVPG 179 V PG+ V LF NK+S Q+ +++Q +++PSV FLKV+VE P +A+SE +S VP Sbjct: 598 VTSPGMSVVLFCNKTSHK--QVLQLLEQVCKRYPSVYFLKVEVEDHPYLAKSESVSSVPA 655 Query: 178 FKMYRNGSSVKDIAGSEFEQLEDCIKSFST 89 FK+Y+NGS VK+I G+ E LE +K +S+ Sbjct: 656 FKIYKNGSRVKEIPGNNRELLESSVKLYSS 685