BLASTX nr result
ID: Ophiopogon23_contig00035279
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00035279 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248358.1| probable sugar phosphate/phosphate transloca... 56 4e-06 ref|XP_020248341.1| probable sugar phosphate/phosphate transloca... 56 5e-06 >ref|XP_020248358.1| probable sugar phosphate/phosphate translocator At1g06470 isoform X2 [Asparagus officinalis] gb|ONK80570.1| uncharacterized protein A4U43_C01F19300 [Asparagus officinalis] Length = 305 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 525 KKFKRGQRNENGEPMSPASVTSKYVVLDEIDSEDDDT 415 +KFK+GQ NE GE MSP++VT+KYV+LD ID +DDDT Sbjct: 269 QKFKKGQTNEYGELMSPSTVTAKYVILDGIDFQDDDT 305 >ref|XP_020248341.1| probable sugar phosphate/phosphate translocator At1g06470 isoform X1 [Asparagus officinalis] ref|XP_020248349.1| probable sugar phosphate/phosphate translocator At1g06470 isoform X1 [Asparagus officinalis] Length = 479 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 525 KKFKRGQRNENGEPMSPASVTSKYVVLDEIDSEDDDT 415 +KFK+GQ NE GE MSP++VT+KYV+LD ID +DDDT Sbjct: 443 QKFKKGQTNEYGELMSPSTVTAKYVILDGIDFQDDDT 479