BLASTX nr result
ID: Ophiopogon23_contig00035252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00035252 (862 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008785882.1| PREDICTED: F-box/kelch-repeat protein At5g43... 42 3e-06 >ref|XP_008785882.1| PREDICTED: F-box/kelch-repeat protein At5g43190-like [Phoenix dactylifera] Length = 386 Score = 42.0 bits (97), Expect(2) = 3e-06 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +2 Query: 170 FSFDGKLLLVGGMEELGAIVGIGIWELDWGRLE 268 F + L LVGG+EE+G + +GIWELDW + E Sbjct: 242 FDLEHCLFLVGGVEEVGCMARVGIWELDWPKKE 274 Score = 38.1 bits (87), Expect(2) = 3e-06 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +1 Query: 58 LVYCSGSSPDRLLTFDPVGGRWQVSDVDFPATRSLHL 168 L+ PD LLTFDP+GG W + DV P H+ Sbjct: 205 LLLVLSQGPDHLLTFDPIGGDWNLIDVAMPPVVCSHI 241