BLASTX nr result
ID: Ophiopogon23_contig00034974
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00034974 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260697.1| uncharacterized protein LOC109837027 [Aspara... 55 2e-06 >ref|XP_020260697.1| uncharacterized protein LOC109837027 [Asparagus officinalis] gb|ONK71605.1| uncharacterized protein A4U43_C04F10410 [Asparagus officinalis] Length = 163 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +1 Query: 328 MRQAAGGLWYRAQGKWQVRRICYKIFDQWSEKN 426 M Q AG LW RAQGKWQV+RIC KIF+QW EK+ Sbjct: 1 MGQVAGHLWDRAQGKWQVQRICDKIFNQWPEKD 33