BLASTX nr result
ID: Ophiopogon23_contig00034928
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00034928 (725 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010911792.1| PREDICTED: probable pectinesterase/pectinest... 58 4e-06 >ref|XP_010911792.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 51 [Elaeis guineensis] Length = 559 Score = 58.2 bits (139), Expect = 4e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 720 NDSGRVEWSSRIPAERLGAYSLRSFIQGDEWATSS 616 N SGRV WSS+IPAE LGAYSL +FIQG+EW SS Sbjct: 514 NSSGRVPWSSQIPAEHLGAYSLENFIQGNEWINSS 548