BLASTX nr result
ID: Ophiopogon23_contig00034856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00034856 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248348.1| pentatricopeptide repeat-containing protein ... 59 5e-07 >ref|XP_020248348.1| pentatricopeptide repeat-containing protein At1g08610-like [Asparagus officinalis] Length = 547 Score = 58.9 bits (141), Expect = 5e-07 Identities = 39/83 (46%), Positives = 50/83 (60%) Frame = +1 Query: 247 MAFAQRFIGDVHSYSLPHSNHDSRPRTRMPAVLDYPSRHDSATSYRLQPRSGSMNVVLNG 426 MAFA R VH YS+P + H S+ TR+PAVL+YPS + LQ +S + NV NG Sbjct: 1 MAFAHRC--GVHCYSVPCTGHSSQ--TRIPAVLEYPSCN-------LQQKSLT-NVAFNG 48 Query: 427 KRGNHNFDKTMAATHSKPARHSN 495 KR N N +K A+ HSKP + N Sbjct: 49 KRVNGNSEKATASRHSKPMKPKN 71