BLASTX nr result
ID: Ophiopogon23_contig00034851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00034851 (651 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF07859.1| phytoene synthase, partial [Oryza sativa Indica G... 58 8e-08 emb|CAI60776.1| phytoene synthase, partial [Crocus sativus] 59 2e-07 gb|AEQ20865.1| phytoene synthase, partial [Eriobotrya japonica] 57 3e-07 gb|ANJ46008.1| phytoene synthase, partial [Phalaenopsis amabilis] 58 4e-07 gb|ANJ46006.1| phytoene synthase, partial [Phalaenopsis lueddema... 58 4e-07 gb|ANJ46007.1| phytoene synthase, partial [Phalaenopsis amabilis] 58 4e-07 gb|ANJ46005.1| phytoene synthase, partial [Phalaenopsis lueddema... 58 4e-07 gb|ANJ46004.1| phytoene synthase, partial [Phalaenopsis violacea] 58 4e-07 dbj|BAW35457.1| phytoene synthase, partial [Rubus palmatus] 57 5e-07 gb|AEL13782.1| phytoene synthase, partial [Taxus baccata] 57 6e-07 gb|PNS96792.1| hypothetical protein POPTR_017G138900v3 [Populus ... 59 7e-07 gb|AFK94155.1| phytoene synthase, partial [Dunaliella salina] 57 8e-07 gb|ACU44500.1| phytoene synthase, partial [Elaeagnus umbellata] 57 1e-06 ref|XP_019435350.1| PREDICTED: phytoene synthase 2, chloroplasti... 59 1e-06 ref|XP_022637742.1| phytoene synthase 2, chloroplastic isoform X... 59 2e-06 ref|XP_014504995.1| phytoene synthase 2, chloroplastic isoform X... 59 2e-06 ref|XP_017430735.1| PREDICTED: phytoene synthase 2, chloroplasti... 59 2e-06 gb|AIU48697.1| phytoene synthase, partial [Pinellia ternata] 58 2e-06 gb|AIU48744.1| phytoene synthase, partial [Trachycarpus fortunei] 58 2e-06 gb|AIU48730.1| phytoene synthase, partial [Yucca filamentosa] 58 2e-06 >gb|ACF07859.1| phytoene synthase, partial [Oryza sativa Indica Group] Length = 84 Score = 58.2 bits (139), Expect = 8e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 36 IWA---IYVWCRRTDELVDGPNASHITPSALDR 65 >emb|CAI60776.1| phytoene synthase, partial [Crocus sativus] Length = 140 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 25 IWA---IYVWCRRTDELVDGPNASYITPSALDR 54 >gb|AEQ20865.1| phytoene synthase, partial [Eriobotrya japonica] Length = 107 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITP ALDR Sbjct: 1 IWA---IYVWCRRTDELVDGPNASYITPKALDR 30 >gb|ANJ46008.1| phytoene synthase, partial [Phalaenopsis amabilis] Length = 151 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 76 IWA---IYVWCRRTDELVDGPNASHITPSALDR 105 >gb|ANJ46006.1| phytoene synthase, partial [Phalaenopsis lueddemanniana] Length = 151 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 76 IWA---IYVWCRRTDELVDGPNASHITPSALDR 105 >gb|ANJ46007.1| phytoene synthase, partial [Phalaenopsis amabilis] Length = 156 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 94 IWA---IYVWCRRTDELVDGPNASHITPSALDR 123 >gb|ANJ46005.1| phytoene synthase, partial [Phalaenopsis lueddemanniana] Length = 156 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 94 IWA---IYVWCRRTDELVDGPNASHITPSALDR 123 >gb|ANJ46004.1| phytoene synthase, partial [Phalaenopsis violacea] Length = 160 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 92 IWA---IYVWCRRTDELVDGPNASHITPSALDR 121 >dbj|BAW35457.1| phytoene synthase, partial [Rubus palmatus] Length = 121 Score = 57.0 bits (136), Expect = 5e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITP ALDR Sbjct: 25 VWA---IYVWCRRTDELVDGPNASYITPKALDR 54 >gb|AEL13782.1| phytoene synthase, partial [Taxus baccata] Length = 145 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 LWA +YVWCRRTDELVDGPNAS ITP ALDR Sbjct: 2 LWA---IYVWCRRTDELVDGPNASHITPKALDR 31 >gb|PNS96792.1| hypothetical protein POPTR_017G138900v3 [Populus trichocarpa] Length = 280 Score = 59.3 bits (142), Expect = 7e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 97 WAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 WA +YVWCRRTDELVDGPNAS ITP+ALDR Sbjct: 13 WAIWAIYVWCRRTDELVDGPNASHITPTALDR 44 >gb|AFK94155.1| phytoene synthase, partial [Dunaliella salina] Length = 138 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITP ALDR Sbjct: 20 IWA---IYVWCRRTDELVDGPNASKITPQALDR 49 >gb|ACU44500.1| phytoene synthase, partial [Elaeagnus umbellata] Length = 135 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITP ALDR Sbjct: 12 IWA---IYVWCRRTDELVDGPNASHITPKALDR 41 >ref|XP_019435350.1| PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] gb|OIW22018.1| hypothetical protein TanjilG_29207 [Lupinus angustifolius] Length = 401 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 138 IWA---IYVWCRRTDELVDGPNASYITPSALDR 167 >ref|XP_022637742.1| phytoene synthase 2, chloroplastic isoform X2 [Vigna radiata var. radiata] Length = 377 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 171 IWA---IYVWCRRTDELVDGPNASQITPSALDR 200 >ref|XP_014504995.1| phytoene synthase 2, chloroplastic isoform X1 [Vigna radiata var. radiata] ref|XP_014504996.1| phytoene synthase 2, chloroplastic isoform X1 [Vigna radiata var. radiata] ref|XP_014504997.1| phytoene synthase 2, chloroplastic isoform X1 [Vigna radiata var. radiata] ref|XP_022637741.1| phytoene synthase 2, chloroplastic isoform X1 [Vigna radiata var. radiata] Length = 435 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 171 IWA---IYVWCRRTDELVDGPNASQITPSALDR 200 >ref|XP_017430735.1| PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] ref|XP_017430736.1| PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] ref|XP_017430737.1| PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] ref|XP_017430738.1| PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] gb|KOM47099.1| hypothetical protein LR48_Vigan07g080300 [Vigna angularis] dbj|BAT81313.1| hypothetical protein VIGAN_03100300 [Vigna angularis var. angularis] Length = 435 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 171 IWA---IYVWCRRTDELVDGPNASQITPSALDR 200 >gb|AIU48697.1| phytoene synthase, partial [Pinellia ternata] Length = 329 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 77 IWA---IYVWCRRTDELVDGPNASHITPSALDR 106 >gb|AIU48744.1| phytoene synthase, partial [Trachycarpus fortunei] Length = 330 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 78 IWA---IYVWCRRTDELVDGPNASHITPSALDR 107 >gb|AIU48730.1| phytoene synthase, partial [Yucca filamentosa] Length = 330 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 100 LWAYIFLYVWCRRTDELVDGPNASLITPSALDR 2 +WA +YVWCRRTDELVDGPNAS ITPSALDR Sbjct: 78 IWA---IYVWCRRTDELVDGPNASHITPSALDR 107