BLASTX nr result
ID: Ophiopogon23_contig00034648
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00034648 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020270316.1| uncharacterized protein LOC109845480 [Aspara... 55 8e-06 >ref|XP_020270316.1| uncharacterized protein LOC109845480 [Asparagus officinalis] Length = 295 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 456 RLITVYTLDSVPSQLVIPNELKCSIGKLVKEAISLT 349 RLITVYTLDSVPSQ+VIP+E+K S+ KLVK ++LT Sbjct: 259 RLITVYTLDSVPSQMVIPDEVKFSVSKLVKALLNLT 294