BLASTX nr result
ID: Ophiopogon23_contig00033214
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00033214 (623 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN10498.1| hypothetical protein CDL12_16920 [Handroanthus im... 46 9e-06 >gb|PIN10498.1| hypothetical protein CDL12_16920 [Handroanthus impetiginosus] Length = 73 Score = 45.8 bits (107), Expect(2) = 9e-06 Identities = 19/31 (61%), Positives = 26/31 (83%) Frame = -3 Query: 504 DREGSITDGGKDTIHTINYAWAMRQMAMEKV 412 DR GSIT+GG+DTIH + YAWAM+Q+ E++ Sbjct: 20 DRLGSITEGGQDTIHMVYYAWAMQQLDPEEL 50 Score = 32.0 bits (71), Expect(2) = 9e-06 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -2 Query: 421 GEGTLYPECRLREMQQVGVQALI 353 GEG Y +LREMQQ+GV+ALI Sbjct: 51 GEGASYSIWKLREMQQLGVRALI 73