BLASTX nr result
ID: Ophiopogon23_contig00033062
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00033062 (468 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272965.1| delta(24)-sterol reductase-like [Asparagus o... 106 1e-23 gb|ONK64287.1| uncharacterized protein A4U43_C07F24100 [Asparagu... 106 1e-23 ref|XP_012827495.1| PREDICTED: delta(24)-sterol reductase [Eryth... 102 3e-22 gb|ABD60147.1| diminuto, partial [Morus alba] 94 1e-21 dbj|BAE16980.1| sterol C-24 reductase [Zinnia violacea] 100 2e-21 ref|XP_017226696.1| PREDICTED: delta(24)-sterol reductase [Daucu... 100 2e-21 gb|KVE23423.1| hypothetical protein Ccrd_024036 [Cynara carduncu... 92 2e-21 gb|ARL62106.1| sterol delta24 reductase [Calotropis procera] 99 6e-21 ref|XP_021607500.1| delta(24)-sterol reductase [Manihot esculent... 99 6e-21 ref|XP_022853500.1| delta(24)-sterol reductase [Olea europaea va... 99 6e-21 gb|AIH07331.1| sterol C-24 reductase [Echinacea purpurea] 98 8e-21 ref|XP_019450950.1| PREDICTED: delta(24)-sterol reductase-like [... 96 9e-21 gb|PIM99415.1| FAD-binding protein DIMINUTO [Handroanthus impeti... 98 1e-20 gb|PHU25005.1| Delta(24)-sterol reductase [Capsicum chinense] 97 1e-20 gb|PHT54932.1| Delta(24)-sterol reductase [Capsicum baccatum] 97 1e-20 ref|XP_016558623.1| PREDICTED: delta(24)-sterol reductase [Capsi... 97 1e-20 emb|CBI27447.3| unnamed protein product, partial [Vitis vinifera] 97 2e-20 gb|KDP47007.1| hypothetical protein JCGZ_10734 [Jatropha curcas] 97 2e-20 gb|OIW08838.1| hypothetical protein TanjilG_16419 [Lupinus angus... 96 2e-20 ref|XP_023766113.1| delta(24)-sterol reductase-like [Lactuca sat... 97 2e-20 >ref|XP_020272965.1| delta(24)-sterol reductase-like [Asparagus officinalis] ref|XP_020272967.1| delta(24)-sterol reductase-like [Asparagus officinalis] Length = 560 Score = 106 bits (264), Expect = 1e-23 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGEEFDGVEAVRRLEDWLI+NH FQPQYAVSELNEKNFWRMFDGGLYEQ Sbjct: 467 LRGEEFDGVEAVRRLEDWLIKNHSFQPQYAVSELNEKNFWRMFDGGLYEQ 516 >gb|ONK64287.1| uncharacterized protein A4U43_C07F24100 [Asparagus officinalis] Length = 647 Score = 106 bits (264), Expect = 1e-23 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGEEFDGVEAVRRLEDWLI+NH FQPQYAVSELNEKNFWRMFDGGLYEQ Sbjct: 554 LRGEEFDGVEAVRRLEDWLIKNHSFQPQYAVSELNEKNFWRMFDGGLYEQ 603 >ref|XP_012827495.1| PREDICTED: delta(24)-sterol reductase [Erythranthe guttata] ref|XP_012827496.1| PREDICTED: delta(24)-sterol reductase [Erythranthe guttata] gb|EYU19065.1| hypothetical protein MIMGU_mgv1a003798mg [Erythranthe guttata] gb|EYU19066.1| hypothetical protein MIMGU_mgv1a003798mg [Erythranthe guttata] Length = 563 Score = 102 bits (253), Expect = 3e-22 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGE+FDG EAV RLEDWLI+NHGFQPQYAVSELNEKNFWRMFD GLYEQ Sbjct: 470 LRGEQFDGAEAVHRLEDWLIENHGFQPQYAVSELNEKNFWRMFDAGLYEQ 519 >gb|ABD60147.1| diminuto, partial [Morus alba] Length = 128 Score = 94.0 bits (232), Expect = 1e-21 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYE 147 LRGE FDG AVR++EDWLI+NHGFQPQYAVSEL+EKNFWRMFD GLYE Sbjct: 53 LRGEVFDGAGAVRKMEDWLIENHGFQPQYAVSELSEKNFWRMFDAGLYE 101 >dbj|BAE16980.1| sterol C-24 reductase [Zinnia violacea] Length = 563 Score = 99.8 bits (247), Expect = 2e-21 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGE FDGV+AVRR+E WLI+NHGFQPQYAVSELNEKNFWRMFD GLYEQ Sbjct: 470 LRGEVFDGVDAVRRMESWLIENHGFQPQYAVSELNEKNFWRMFDAGLYEQ 519 >ref|XP_017226696.1| PREDICTED: delta(24)-sterol reductase [Daucus carota subsp. sativus] ref|XP_017226697.1| PREDICTED: delta(24)-sterol reductase [Daucus carota subsp. sativus] gb|KZM82836.1| hypothetical protein DCAR_030405 [Daucus carota subsp. sativus] Length = 567 Score = 99.8 bits (247), Expect = 2e-21 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGEEFDG EAVRRLE WLI+NHGFQPQYAVSELNEK+FW+MFD GLYEQ Sbjct: 470 LRGEEFDGAEAVRRLESWLIENHGFQPQYAVSELNEKSFWKMFDAGLYEQ 519 >gb|KVE23423.1| hypothetical protein Ccrd_024036 [Cynara cardunculus var. scolymus] Length = 108 Score = 92.4 bits (228), Expect = 2e-21 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +1 Query: 4 RGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 RGE FDG +AVRRLE WLI+NHGFQPQYAVSEL+EK FWRMFD GLYEQ Sbjct: 16 RGEVFDGCDAVRRLETWLIENHGFQPQYAVSELDEKKFWRMFDAGLYEQ 64 >gb|ARL62106.1| sterol delta24 reductase [Calotropis procera] Length = 563 Score = 98.6 bits (244), Expect = 6e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGE FDG EAVRR+E WLI+NHGFQPQYAVSEL+EKNFWRMFDGGLYE+ Sbjct: 470 LRGEVFDGAEAVRRMESWLIENHGFQPQYAVSELSEKNFWRMFDGGLYEE 519 >ref|XP_021607500.1| delta(24)-sterol reductase [Manihot esculenta] gb|OAY54518.1| hypothetical protein MANES_03G081200 [Manihot esculenta] Length = 563 Score = 98.6 bits (244), Expect = 6e-21 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +1 Query: 4 RGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 RGEEFDG EAVRR+E+WLI+NHGFQPQYAVSEL EKNFWRMFD GLYEQ Sbjct: 471 RGEEFDGAEAVRRMENWLIENHGFQPQYAVSELTEKNFWRMFDAGLYEQ 519 >ref|XP_022853500.1| delta(24)-sterol reductase [Olea europaea var. sylvestris] ref|XP_022853502.1| delta(24)-sterol reductase [Olea europaea var. sylvestris] ref|XP_022853503.1| delta(24)-sterol reductase [Olea europaea var. sylvestris] Length = 568 Score = 98.6 bits (244), Expect = 6e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGE FDG +AVRR+E+WLI+NHGFQPQYAVSELNEKNFWRMFD GLYEQ Sbjct: 470 LRGEVFDGADAVRRMENWLIENHGFQPQYAVSELNEKNFWRMFDAGLYEQ 519 >gb|AIH07331.1| sterol C-24 reductase [Echinacea purpurea] Length = 563 Score = 98.2 bits (243), Expect = 8e-21 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGE FDG +AVRR+E WLI+NHGFQPQYAVSELNEKNFWRMFD GLYEQ Sbjct: 470 LRGEVFDGADAVRRMESWLIENHGFQPQYAVSELNEKNFWRMFDAGLYEQ 519 >ref|XP_019450950.1| PREDICTED: delta(24)-sterol reductase-like [Lupinus angustifolius] Length = 333 Score = 96.3 bits (238), Expect = 9e-21 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGE FDG EAVR+LE W+I+NHGFQPQYAVSEL+EKNFWRMFD GLYEQ Sbjct: 236 LRGEVFDGAEAVRKLESWMIENHGFQPQYAVSELSEKNFWRMFDAGLYEQ 285 >gb|PIM99415.1| FAD-binding protein DIMINUTO [Handroanthus impetiginosus] gb|PIN17739.1| FAD-binding protein DIMINUTO [Handroanthus impetiginosus] Length = 564 Score = 97.8 bits (242), Expect = 1e-20 Identities = 42/50 (84%), Positives = 48/50 (96%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGEEFDG EAVR++E+WLI+NHGFQPQYAVSEL+EKNFWRMFD GLYE+ Sbjct: 471 LRGEEFDGAEAVRKMENWLIENHGFQPQYAVSELSEKNFWRMFDAGLYER 520 >gb|PHU25005.1| Delta(24)-sterol reductase [Capsicum chinense] Length = 567 Score = 97.4 bits (241), Expect = 1e-20 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYE 147 LRGE FDG+EAVR++E WLI+NHGFQPQYAVSEL EKNFWRMFDGGLYE Sbjct: 470 LRGEVFDGIEAVRKMESWLIENHGFQPQYAVSELTEKNFWRMFDGGLYE 518 >gb|PHT54932.1| Delta(24)-sterol reductase [Capsicum baccatum] Length = 567 Score = 97.4 bits (241), Expect = 1e-20 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYE 147 LRGE FDG+EAVR++E WLI+NHGFQPQYAVSEL EKNFWRMFDGGLYE Sbjct: 470 LRGEVFDGIEAVRKMESWLIENHGFQPQYAVSELTEKNFWRMFDGGLYE 518 >ref|XP_016558623.1| PREDICTED: delta(24)-sterol reductase [Capsicum annuum] gb|PHT89941.1| Delta(24)-sterol reductase [Capsicum annuum] Length = 567 Score = 97.4 bits (241), Expect = 1e-20 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYE 147 LRGE FDG+EAVR++E WLI+NHGFQPQYAVSEL EKNFWRMFDGGLYE Sbjct: 470 LRGEVFDGIEAVRKMESWLIENHGFQPQYAVSELTEKNFWRMFDGGLYE 518 >emb|CBI27447.3| unnamed protein product, partial [Vitis vinifera] Length = 474 Score = 97.1 bits (240), Expect = 2e-20 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYE 147 LRGE+FDG EAVRR+E+WLI+NHGFQPQYAVSEL EKNFWRMFD GLYE Sbjct: 381 LRGEQFDGAEAVRRMENWLIENHGFQPQYAVSELTEKNFWRMFDAGLYE 429 >gb|KDP47007.1| hypothetical protein JCGZ_10734 [Jatropha curcas] Length = 512 Score = 97.1 bits (240), Expect = 2e-20 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +1 Query: 4 RGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 RGE FDG EAVRRLE+WLI+NHGFQPQYAVSEL+EKNFWRMFD GLYEQ Sbjct: 420 RGEVFDGAEAVRRLENWLIENHGFQPQYAVSELSEKNFWRMFDAGLYEQ 468 >gb|OIW08838.1| hypothetical protein TanjilG_16419 [Lupinus angustifolius] Length = 397 Score = 96.3 bits (238), Expect = 2e-20 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGE FDG EAVR+LE W+I+NHGFQPQYAVSEL+EKNFWRMFD GLYEQ Sbjct: 300 LRGEVFDGAEAVRKLESWMIENHGFQPQYAVSELSEKNFWRMFDAGLYEQ 349 >ref|XP_023766113.1| delta(24)-sterol reductase-like [Lactuca sativa] gb|PLY83694.1| hypothetical protein LSAT_4X26521 [Lactuca sativa] Length = 563 Score = 97.1 bits (240), Expect = 2e-20 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +1 Query: 1 LRGEEFDGVEAVRRLEDWLIQNHGFQPQYAVSELNEKNFWRMFDGGLYEQ 150 LRGE FDG +AVRR+E+WLI+NHGFQPQYAVSELNEKNFWRMF+ GLYEQ Sbjct: 470 LRGEVFDGADAVRRMENWLIENHGFQPQYAVSELNEKNFWRMFEAGLYEQ 519