BLASTX nr result
ID: Ophiopogon23_contig00033045
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00033045 (596 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60641.1| uncharacterized protein A4U43_C08F20900 [Asparagu... 67 2e-09 >gb|ONK60641.1| uncharacterized protein A4U43_C08F20900 [Asparagus officinalis] Length = 412 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 184 NLVAFCVRFIEAVPWTDDEEDRVLQILPFLSSDESCD 74 +LVAFCVRFIEAVPWTDDEE+++LQILPFL DES D Sbjct: 170 DLVAFCVRFIEAVPWTDDEEEQILQILPFLKPDESRD 206