BLASTX nr result
ID: Ophiopogon23_contig00032784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00032784 (690 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242958.1| histone deacetylase 5-like [Asparagus offici... 63 8e-08 gb|ONK60192.1| uncharacterized protein A4U43_C08F15360 [Asparagu... 63 8e-08 ref|XP_010939166.1| PREDICTED: histone deacetylase 5 [Elaeis gui... 57 9e-06 ref|XP_017698767.1| PREDICTED: histone deacetylase 5-like isofor... 57 9e-06 ref|XP_017698766.1| PREDICTED: histone deacetylase 5-like isofor... 57 9e-06 >ref|XP_020242958.1| histone deacetylase 5-like [Asparagus officinalis] Length = 721 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 598 QVDGMNKPCHGSRDKSLPRDVFWKIVPHKLF 690 + +GMNKPC GSRDKSLPRDVFW IVPHKLF Sbjct: 536 KAEGMNKPCRGSRDKSLPRDVFWNIVPHKLF 566 >gb|ONK60192.1| uncharacterized protein A4U43_C08F15360 [Asparagus officinalis] Length = 730 Score = 63.2 bits (152), Expect = 8e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 598 QVDGMNKPCHGSRDKSLPRDVFWKIVPHKLF 690 + +GMNKPC GSRDKSLPRDVFW IVPHKLF Sbjct: 545 KAEGMNKPCRGSRDKSLPRDVFWNIVPHKLF 575 >ref|XP_010939166.1| PREDICTED: histone deacetylase 5 [Elaeis guineensis] Length = 691 Score = 57.0 bits (136), Expect = 9e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 598 QVDGMNKPCHGSRDKSLPRDVFWKIVPHKLF 690 +V+GMNKPC GSRDKS P+DV WK VPH+LF Sbjct: 501 KVEGMNKPCPGSRDKSSPKDVIWKTVPHRLF 531 >ref|XP_017698767.1| PREDICTED: histone deacetylase 5-like isoform X3 [Phoenix dactylifera] Length = 699 Score = 57.0 bits (136), Expect = 9e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 598 QVDGMNKPCHGSRDKSLPRDVFWKIVPHKLF 690 QV+GMN+PC GSRDKS P+DV WK VPH+LF Sbjct: 509 QVEGMNEPCPGSRDKSSPKDVIWKTVPHRLF 539 >ref|XP_017698766.1| PREDICTED: histone deacetylase 5-like isoform X1 [Phoenix dactylifera] Length = 735 Score = 57.0 bits (136), Expect = 9e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 598 QVDGMNKPCHGSRDKSLPRDVFWKIVPHKLF 690 QV+GMN+PC GSRDKS P+DV WK VPH+LF Sbjct: 545 QVEGMNEPCPGSRDKSSPKDVIWKTVPHRLF 575