BLASTX nr result
ID: Ophiopogon23_contig00032573
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00032573 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021629463.1| AP2-like ethylene-responsive transcription f... 54 8e-06 >ref|XP_021629463.1| AP2-like ethylene-responsive transcription factor ANT isoform X1 [Manihot esculenta] Length = 708 Score = 54.3 bits (129), Expect = 8e-06 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 2/85 (2%) Frame = +3 Query: 153 LENYHEQLKEIRNESIPEYVVHL-RKAVGFLEGLQCIMELTRFYFL-L*ILNKVLYVLIS 326 LENY ++L+E++N + EYV HL RK+ GF G +TR + L +LN + Sbjct: 394 LENYQKELEEMKNMTRQEYVAHLRRKSSGFSRGASMYRGVTRSNLINLNLLNIFKVCCLK 453 Query: 327 HMKFVF*TIIFYFSFSRHHQHRRWQ 401 FV+ + FSRHHQH RWQ Sbjct: 454 KRNFVYLSQF----FSRHHQHGRWQ 474