BLASTX nr result
ID: Ophiopogon23_contig00032502
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00032502 (541 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252754.1| pentatricopeptide repeat-containing protein ... 73 7e-12 >ref|XP_020252754.1| pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Asparagus officinalis] ref|XP_020252755.1| pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Asparagus officinalis] ref|XP_020252756.1| pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Asparagus officinalis] gb|ONK77107.1| uncharacterized protein A4U43_C02F3170 [Asparagus officinalis] Length = 824 Score = 72.8 bits (177), Expect(2) = 7e-12 Identities = 31/52 (59%), Positives = 40/52 (76%) Frame = +2 Query: 284 PPIEEAHAIKFLLNNRRNPRTALQYYKSVAMDGFFTLDSFCLLLRILVKGGR 439 PPI E +FLL+N+RNP+TAL+Y+KS DGFF LD FC+LL IL++ GR Sbjct: 50 PPIREHQVTQFLLSNQRNPKTALRYFKSAVKDGFFALDPFCILLHILIRSGR 101 Score = 25.0 bits (53), Expect(2) = 7e-12 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 459 ELIMNTVLGISSLKGPGIFDRLVETSK 539 EL+ +++L SS + + D+LVETSK Sbjct: 107 ELLKDSLLSDSSPEPSDVVDKLVETSK 133