BLASTX nr result
ID: Ophiopogon23_contig00032160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00032160 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65777.1| uncharacterized protein A4U43_C06F870 [Asparagus ... 56 2e-06 ref|XP_020269391.1| uncharacterized protein LOC109844686, partia... 56 2e-06 >gb|ONK65777.1| uncharacterized protein A4U43_C06F870 [Asparagus officinalis] Length = 629 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 105 QGYFVLPEVGKA*HNIWTVNITTSAENSCFGNR 203 +GYF+LPEV K HNI TVN+T SAENSCFGNR Sbjct: 212 KGYFLLPEVAKTQHNIRTVNVTMSAENSCFGNR 244 >ref|XP_020269391.1| uncharacterized protein LOC109844686, partial [Asparagus officinalis] Length = 660 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 105 QGYFVLPEVGKA*HNIWTVNITTSAENSCFGNR 203 +GYF+LPEV K HNI TVN+T SAENSCFGNR Sbjct: 261 KGYFLLPEVAKTQHNIRTVNVTMSAENSCFGNR 293