BLASTX nr result
ID: Ophiopogon23_contig00032159
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00032159 (959 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251734.1| uncharacterized protein LOC109829069 [Aspara... 51 5e-09 >ref|XP_020251734.1| uncharacterized protein LOC109829069 [Asparagus officinalis] gb|ONK78932.1| uncharacterized protein A4U43_C01F1130 [Asparagus officinalis] Length = 364 Score = 50.8 bits (120), Expect(2) = 5e-09 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 6/58 (10%) Frame = +1 Query: 802 VGD-RVLILHVKCSASFLAADLGVPGNRVYC-----SGSTPWQVFDLGAGRLTDESPP 957 VGD RV+++H S S LAAD+G GN +Y SG PW+VFDLG ++TD P Sbjct: 289 VGDNRVIVIHWVQSVSLLAADIGARGNCIYFATGENSGQGPWKVFDLGTRKMTDLQLP 346 Score = 39.3 bits (90), Expect(2) = 5e-09 Identities = 22/45 (48%), Positives = 29/45 (64%) Frame = +3 Query: 669 LVESDGEVLLVAEILEDGPVRSILDIHVFRADLSKKMWVRMHSLG 803 LVE E LLV EIL G + + V+RADL +KMWV++ S+G Sbjct: 248 LVEFGEEPLLVKEILGYGTIP--VGFEVYRADLDRKMWVKVESVG 290