BLASTX nr result
ID: Ophiopogon23_contig00032150
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00032150 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAU81597.1| cysteine proteinase inhibitor [Petunia x hybrida] 42 1e-06 ref|NP_001312690.1| cysteine proteinase inhibitor 6-like precurs... 44 2e-06 ref|XP_017408788.1| PREDICTED: cysteine proteinase inhibitor 6 [... 41 2e-06 gb|AAC37479.1| cysteine proteinase inhibitor [Brassica rapa subs... 43 2e-06 ref|XP_023641578.1| cysteine proteinase inhibitor 6 [Capsella ru... 43 3e-06 ref|XP_016493981.1| PREDICTED: cysteine proteinase inhibitor 6-l... 42 3e-06 emb|CAH57531.1| cysteine protease inhibitor [Populus tremula] 42 3e-06 >gb|AAU81597.1| cysteine proteinase inhibitor [Petunia x hybrida] Length = 252 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 23/54 (42%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +2 Query: 32 GGIKDTMIDXXXXXXXXXXXXXAQDEHNKKRNALLEFARVVKAR---AVGCRHH 184 GGI+D+ + A DEHNKK NA+ E ARVVKA+ G HH Sbjct: 55 GGIRDSHPESQNSDEIHSLAKFAVDEHNKKENAMFELARVVKAKEQVVAGTLHH 108 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +1 Query: 196 LEAIDAG*TKLYVTKVRVRPLLNFK*LL-LRHYHPFGPLVRSEMGMTKMKWC 348 LE +DAG KLY KV V+P LNFK L H + S++G+ K + C Sbjct: 111 LEVVDAGKKKLYEAKVWVKPWLNFKELQEFTHVEDAPAITSSDLGVKKEEQC 162 >ref|NP_001312690.1| cysteine proteinase inhibitor 6-like precursor [Nicotiana tabacum] ref|XP_009601821.1| PREDICTED: cysteine proteinase inhibitor 6 [Nicotiana tomentosiformis] gb|AIE76375.1| cysteine protease inhibitor [Nicotiana tabacum] Length = 251 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 24/54 (44%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +2 Query: 32 GGIKDTMIDXXXXXXXXXXXXXAQDEHNKKRNALLEFARVVKAR---AVGCRHH 184 GGI+D+ A DEHNKK NA++E ARVVKAR G HH Sbjct: 53 GGIRDSHASSQNSDEIHNLAKFAVDEHNKKENAMIELARVVKAREQVVAGTLHH 106 Score = 35.8 bits (81), Expect(2) = 2e-06 Identities = 22/46 (47%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 196 LEAIDAG*TKLYVTKVRVRPLLNFK*LL-LRHYHPFGPLVRSEMGM 330 LE IDAG KLY KV V+P LNFK L H L S++G+ Sbjct: 109 LEVIDAGKKKLYEAKVWVKPWLNFKELQEFSHVEDVPTLTSSDLGV 154 >ref|XP_017408788.1| PREDICTED: cysteine proteinase inhibitor 6 [Vigna angularis] gb|KOM28344.1| hypothetical protein LR48_Vigan528s001500 [Vigna angularis] dbj|BAT89361.1| hypothetical protein VIGAN_06030100 [Vigna angularis var. angularis] Length = 246 Score = 41.2 bits (95), Expect(2) = 2e-06 Identities = 21/32 (65%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = +2 Query: 98 AQDEHNKKRNALLEFARVVKAR---AVGCRHH 184 A DEHNKK+N+LLEFARVVKA+ G HH Sbjct: 71 AVDEHNKKQNSLLEFARVVKAQEQVVAGTVHH 102 Score = 37.7 bits (86), Expect(2) = 2e-06 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Frame = +1 Query: 196 LEAIDAG*TKLYVTKVRVRPLLNFK*LLLRHYHPFG---PLVRSEMGMTK 336 LEAI+AG KLY KV V+P LNFK L+ + P G P +++G+ K Sbjct: 105 LEAIEAGEKKLYEAKVWVKPWLNFK--ELQEFKPAGVASPFTSADLGVKK 152 >gb|AAC37479.1| cysteine proteinase inhibitor [Brassica rapa subsp. oleifera] Length = 199 Score = 43.1 bits (100), Expect(2) = 2e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = +2 Query: 98 AQDEHNKKRNALLEFARVVKAR---AVGCRHH 184 A DEHNKK NALLEFARVVKA+ G HH Sbjct: 26 AVDEHNKKENALLEFARVVKAKEQVVAGTMHH 57 Score = 35.8 bits (81), Expect(2) = 2e-06 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +1 Query: 196 LEAIDAG*TKLYVTKVRVRPLLNFK*LLLRHYHPFGPLVRSEMGMTK 336 LE I+AG KLY KV V+P LNFK L+ + P + S++G K Sbjct: 60 LEIIEAGKKKLYEAKVWVKPWLNFK--ELQEFKPSTTITPSDLGCKK 104 >ref|XP_023641578.1| cysteine proteinase inhibitor 6 [Capsella rubella] gb|EOA31346.1| hypothetical protein CARUB_v10014520mg [Capsella rubella] Length = 236 Score = 42.7 bits (99), Expect(2) = 3e-06 Identities = 22/32 (68%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = +2 Query: 98 AQDEHNKKRNALLEFARVVKAR---AVGCRHH 184 A DEHNKK NALLEFARVVKA+ G HH Sbjct: 64 AVDEHNKKENALLEFARVVKAKEQVVAGTLHH 95 Score = 35.8 bits (81), Expect(2) = 3e-06 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +1 Query: 196 LEAIDAG*TKLYVTKVRVRPLLNFK*LLLRHYHPFGPLVRSEMGMTK 336 LE ++AG KLY KV V+P LNFK L+ + P + S++G K Sbjct: 98 LEILEAGQKKLYEAKVWVKPWLNFK--ELQEFKPASAITPSDLGCKK 142 >ref|XP_016493981.1| PREDICTED: cysteine proteinase inhibitor 6-like isoform X2 [Nicotiana tabacum] Length = 214 Score = 42.0 bits (97), Expect(2) = 3e-06 Identities = 23/54 (42%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = +2 Query: 32 GGIKDTMIDXXXXXXXXXXXXXAQDEHNKKRNALLEFARVVKAR---AVGCRHH 184 GGI+D+ A DEHNKK NA++E ARVVKA+ G HH Sbjct: 51 GGIRDSHASSQNSDEIHNLAKFAVDEHNKKENAMIELARVVKAQEQVVAGTLHH 104 Score = 36.6 bits (83), Expect(2) = 3e-06 Identities = 28/74 (37%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Frame = +1 Query: 196 LEAIDAG*TKLYVTKVRVRPLLNFK*LL-LRHYHPFGPLVRSEMGMTKMKWCCPMILLSK 372 LE IDAG KLY KV V+P LNFK L H L S++G+ + + Sbjct: 107 LEVIDAGKKKLYEAKVWVKPWLNFKELQEFTHVEDVPTLTSSDLGVKQGDIGLSQV-CHY 165 Query: 373 IQQLMVLITSVYNY 414 IQ L+VL++ Y Sbjct: 166 IQMLLVLLSRFLLY 179 >emb|CAH57531.1| cysteine protease inhibitor [Populus tremula] Length = 143 Score = 42.4 bits (98), Expect(2) = 3e-06 Identities = 21/32 (65%), Positives = 23/32 (71%), Gaps = 3/32 (9%) Frame = +2 Query: 98 AQDEHNKKRNALLEFARVVKAR---AVGCRHH 184 A DEHNKK NA+LEFARVVKA+ G HH Sbjct: 61 AVDEHNKKENAILEFARVVKAKEQVVAGTMHH 92 Score = 36.2 bits (82), Expect(2) = 3e-06 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +1 Query: 196 LEAIDAG*TKLYVTKVRVRPLLNFK 270 +EAI+AG KLY KVRV+P LNFK Sbjct: 95 IEAIEAGKKKLYEAKVRVKPWLNFK 119