BLASTX nr result
ID: Ophiopogon23_contig00031867
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00031867 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272079.1| pentatricopeptide repeat-containing protein ... 137 6e-35 ref|XP_010911329.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-22 ref|XP_020098836.1| pentatricopeptide repeat-containing protein ... 99 2e-21 ref|XP_020596243.1| pentatricopeptide repeat-containing protein ... 97 7e-21 ref|XP_020596242.1| pentatricopeptide repeat-containing protein ... 97 7e-21 ref|XP_020596241.1| pentatricopeptide repeat-containing protein ... 97 8e-21 ref|XP_020596240.1| pentatricopeptide repeat-containing protein ... 97 8e-21 ref|XP_020697045.1| pentatricopeptide repeat-containing protein ... 95 5e-20 ref|XP_024027800.1| pentatricopeptide repeat-containing protein ... 88 2e-17 gb|EXB36428.1| hypothetical protein L484_009995 [Morus notabilis] 88 2e-17 ref|XP_010242769.1| PREDICTED: pentatricopeptide repeat-containi... 86 6e-17 ref|XP_021686864.1| pentatricopeptide repeat-containing protein ... 85 7e-17 gb|OVA03747.1| Pentatricopeptide repeat [Macleaya cordata] 86 8e-17 ref|XP_021686857.1| pentatricopeptide repeat-containing protein ... 85 1e-16 ref|XP_024173548.1| pentatricopeptide repeat-containing protein ... 86 1e-16 ref|XP_024173547.1| pentatricopeptide repeat-containing protein ... 86 1e-16 ref|XP_024173545.1| pentatricopeptide repeat-containing protein ... 86 1e-16 ref|XP_008218792.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-16 ref|XP_021800676.1| pentatricopeptide repeat-containing protein ... 84 4e-16 ref|XP_007225150.2| pentatricopeptide repeat-containing protein ... 84 4e-16 >ref|XP_020272079.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Asparagus officinalis] ref|XP_020272085.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Asparagus officinalis] ref|XP_020272089.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Asparagus officinalis] ref|XP_020272093.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Asparagus officinalis] Length = 681 Score = 137 bits (345), Expect = 6e-35 Identities = 71/123 (57%), Positives = 80/123 (65%) Frame = +3 Query: 42 IIGTNPRKNHSSAKRSSLFVLNCSKTLDKPPQSSTSTLSXXXXXXXXXXXXXXXXXDLDS 221 +I + KN + +RS LF +NCSK LDKP S DL S Sbjct: 50 LISSKNPKNDAKLQRSGLFFVNCSKALDKPQTSPIFVADAKQAAIARVKSAS----DLSS 105 Query: 222 VLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIGISRN 401 LS ADGILQVQDLNFILRYFGESRRWH++ QVFDWM KN VNF SYSSFIKY+GISRN Sbjct: 106 ALSSADGILQVQDLNFILRYFGESRRWHQVSQVFDWMLKNENVNFASYSSFIKYMGISRN 165 Query: 402 PMK 410 P+K Sbjct: 166 PLK 168 >ref|XP_010911329.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Elaeis guineensis] ref|XP_010911463.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Elaeis guineensis] Length = 658 Score = 102 bits (254), Expect = 1e-22 Identities = 59/125 (47%), Positives = 73/125 (58%), Gaps = 9/125 (7%) Frame = +3 Query: 63 KNHSSAKRSSLFVLNCSKTLDKPPQSSTSTLSXXXXXXXXXXXXXXXXX---------DL 215 +NH +R + SKTLDKP S+++ S DL Sbjct: 27 RNHRYPRR----IPAVSKTLDKPHASTSAASSSSSPATIRPSNSSARRIAIAEVEASTDL 82 Query: 216 DSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIGIS 395 DS LS +GILQVQD N IL YFGE RRW E+ Q+FDWMQ++ ++NF SYSSFIKY+GIS Sbjct: 83 DSTLSRVEGILQVQDYNNILCYFGELRRWTEVSQLFDWMQRHEKLNFSSYSSFIKYMGIS 142 Query: 396 RNPMK 410 NPMK Sbjct: 143 HNPMK 147 >ref|XP_020098836.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Ananas comosus] Length = 683 Score = 99.0 bits (245), Expect = 2e-21 Identities = 43/67 (64%), Positives = 56/67 (83%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DLD+ LS +GIL++QD N ILRYFGESRRW E+ Q+F+WMQK+ +++FVSYSS+ KYIG Sbjct: 106 DLDAALSRVEGILRIQDYNIILRYFGESRRWSEMSQLFEWMQKHEKLDFVSYSSYFKYIG 165 Query: 390 ISRNPMK 410 +S NP K Sbjct: 166 VSCNPAK 172 >ref|XP_020596243.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic isoform X4 [Phalaenopsis equestris] Length = 589 Score = 97.4 bits (241), Expect = 7e-21 Identities = 46/67 (68%), Positives = 54/67 (80%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DL++ LS GIL+V DLN ILRYFGESR W E+ Q+FDWMQKN +NF SYSSFIKY+ Sbjct: 85 DLEASLSRVKGILRVHDLNIILRYFGESRWWREVNQLFDWMQKNEMLNFASYSSFIKYMR 144 Query: 390 ISRNPMK 410 ISRNP+K Sbjct: 145 ISRNPIK 151 >ref|XP_020596242.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic isoform X3 [Phalaenopsis equestris] Length = 598 Score = 97.4 bits (241), Expect = 7e-21 Identities = 46/67 (68%), Positives = 54/67 (80%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DL++ LS GIL+V DLN ILRYFGESR W E+ Q+FDWMQKN +NF SYSSFIKY+ Sbjct: 85 DLEASLSRVKGILRVHDLNIILRYFGESRWWREVNQLFDWMQKNEMLNFASYSSFIKYMR 144 Query: 390 ISRNPMK 410 ISRNP+K Sbjct: 145 ISRNPIK 151 >ref|XP_020596241.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic isoform X2 [Phalaenopsis equestris] Length = 649 Score = 97.4 bits (241), Expect = 8e-21 Identities = 46/67 (68%), Positives = 54/67 (80%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DL++ LS GIL+V DLN ILRYFGESR W E+ Q+FDWMQKN +NF SYSSFIKY+ Sbjct: 85 DLEASLSRVKGILRVHDLNIILRYFGESRWWREVNQLFDWMQKNEMLNFASYSSFIKYMR 144 Query: 390 ISRNPMK 410 ISRNP+K Sbjct: 145 ISRNPIK 151 >ref|XP_020596240.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic isoform X1 [Phalaenopsis equestris] Length = 658 Score = 97.4 bits (241), Expect = 8e-21 Identities = 46/67 (68%), Positives = 54/67 (80%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DL++ LS GIL+V DLN ILRYFGESR W E+ Q+FDWMQKN +NF SYSSFIKY+ Sbjct: 85 DLEASLSRVKGILRVHDLNIILRYFGESRWWREVNQLFDWMQKNEMLNFASYSSFIKYMR 144 Query: 390 ISRNPMK 410 ISRNP+K Sbjct: 145 ISRNPIK 151 >ref|XP_020697045.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like, partial [Dendrobium catenatum] Length = 701 Score = 95.1 bits (235), Expect = 5e-20 Identities = 46/67 (68%), Positives = 53/67 (79%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DL++ LS IL+VQDLN ILRYFGE RRW E+ Q+FDWMQK +NF SYSSFIKY+ Sbjct: 147 DLEATLSRVKEILRVQDLNIILRYFGELRRWIEVNQLFDWMQKAEMLNFASYSSFIKYMR 206 Query: 390 ISRNPMK 410 ISRNPMK Sbjct: 207 ISRNPMK 213 >ref|XP_024027800.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Morus notabilis] Length = 654 Score = 87.8 bits (216), Expect = 2e-17 Identities = 38/67 (56%), Positives = 53/67 (79%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 D S LS +G+L+VQDLN ILR+FG +RWH+L Q+FDWMQ+N +++ SYSS+IK++G Sbjct: 82 DCRSALSRLEGVLKVQDLNAILRHFGTRKRWHDLSQIFDWMQQNGKISASSYSSYIKFLG 141 Query: 390 ISRNPMK 410 S NPM+ Sbjct: 142 ESLNPME 148 >gb|EXB36428.1| hypothetical protein L484_009995 [Morus notabilis] Length = 744 Score = 87.8 bits (216), Expect = 2e-17 Identities = 38/67 (56%), Positives = 53/67 (79%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 D S LS +G+L+VQDLN ILR+FG +RWH+L Q+FDWMQ+N +++ SYSS+IK++G Sbjct: 82 DCRSALSRLEGVLKVQDLNAILRHFGTRKRWHDLSQIFDWMQQNGKISASSYSSYIKFLG 141 Query: 390 ISRNPMK 410 S NPM+ Sbjct: 142 ESLNPME 148 >ref|XP_010242769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic isoform X2 [Nelumbo nucifera] Length = 659 Score = 86.3 bits (212), Expect = 6e-17 Identities = 40/67 (59%), Positives = 52/67 (77%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DLDS L+ + ILQVQDLN ILR+FG+ RW + Q+FDWMQK+ +VN SYSS+IK++G Sbjct: 86 DLDSALARSGEILQVQDLNVILRHFGKLDRWQYVSQLFDWMQKHGKVNVASYSSYIKFMG 145 Query: 390 ISRNPMK 410 S NP+K Sbjct: 146 KSHNPVK 152 >ref|XP_021686864.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like isoform X2 [Hevea brasiliensis] Length = 337 Score = 85.1 bits (209), Expect = 7e-17 Identities = 37/67 (55%), Positives = 53/67 (79%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DLDS L +G L+VQDLN ILR FG+ RW++L Q+FDWMQ+N++++ S+SS+IK++G Sbjct: 89 DLDSALQRLEGTLKVQDLNVILRNFGKQSRWNDLSQLFDWMQQNDKISVASFSSYIKFMG 148 Query: 390 ISRNPMK 410 S NPM+ Sbjct: 149 KSLNPMR 155 >gb|OVA03747.1| Pentatricopeptide repeat [Macleaya cordata] Length = 692 Score = 85.9 bits (211), Expect = 8e-17 Identities = 38/67 (56%), Positives = 52/67 (77%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 +LDS LS +LQVQDLN ILR+FG+ RW ++ ++FDWM+K ++N SYSSFIK++G Sbjct: 116 NLDSALSRFGAMLQVQDLNVILRHFGKLNRWQDVSKLFDWMKKRGKINIASYSSFIKFMG 175 Query: 390 ISRNPMK 410 SRNP+K Sbjct: 176 KSRNPIK 182 >ref|XP_021686857.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic-like isoform X1 [Hevea brasiliensis] Length = 383 Score = 85.1 bits (209), Expect = 1e-16 Identities = 37/67 (55%), Positives = 53/67 (79%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DLDS L +G L+VQDLN ILR FG+ RW++L Q+FDWMQ+N++++ S+SS+IK++G Sbjct: 89 DLDSALQRLEGTLKVQDLNVILRNFGKQSRWNDLSQLFDWMQQNDKISVASFSSYIKFMG 148 Query: 390 ISRNPMK 410 S NPM+ Sbjct: 149 KSLNPMR 155 >ref|XP_024173548.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic isoform X3 [Rosa chinensis] Length = 587 Score = 85.5 bits (210), Expect = 1e-16 Identities = 46/111 (41%), Positives = 65/111 (58%), Gaps = 10/111 (9%) Frame = +3 Query: 108 CSKTLDK------PPQSSTSTL----SXXXXXXXXXXXXXXXXXDLDSVLSGADGILQVQ 257 C+ TLDK PP S T + S DL+S L+ G L+VQ Sbjct: 39 CATTLDKEPLRRQPPNSDTRRVTRPHSKQYLARQSAILQVQQSSDLESALTRLGGSLKVQ 98 Query: 258 DLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIGISRNPMK 410 DLN I+R+FG +RWH+L Q+F+WMQ+N +++ SYSS+IK++G S NP+K Sbjct: 99 DLNAIIRHFGMLKRWHDLSQLFEWMQQNGKISVSSYSSYIKFMGKSLNPVK 149 >ref|XP_024173547.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic isoform X2 [Rosa chinensis] Length = 636 Score = 85.5 bits (210), Expect = 1e-16 Identities = 46/111 (41%), Positives = 65/111 (58%), Gaps = 10/111 (9%) Frame = +3 Query: 108 CSKTLDK------PPQSSTSTL----SXXXXXXXXXXXXXXXXXDLDSVLSGADGILQVQ 257 C+ TLDK PP S T + S DL+S L+ G L+VQ Sbjct: 39 CATTLDKEPLRRQPPNSDTRRVTRPHSKQYLARQSAILQVQQSSDLESALTRLGGSLKVQ 98 Query: 258 DLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIGISRNPMK 410 DLN I+R+FG +RWH+L Q+F+WMQ+N +++ SYSS+IK++G S NP+K Sbjct: 99 DLNAIIRHFGMLKRWHDLSQLFEWMQQNGKISVSSYSSYIKFMGKSLNPVK 149 >ref|XP_024173545.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic isoform X1 [Rosa chinensis] ref|XP_024173546.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic isoform X1 [Rosa chinensis] gb|PRQ19886.1| putative tetratricopeptide-like helical domain-containing protein [Rosa chinensis] Length = 658 Score = 85.5 bits (210), Expect = 1e-16 Identities = 46/111 (41%), Positives = 65/111 (58%), Gaps = 10/111 (9%) Frame = +3 Query: 108 CSKTLDK------PPQSSTSTL----SXXXXXXXXXXXXXXXXXDLDSVLSGADGILQVQ 257 C+ TLDK PP S T + S DL+S L+ G L+VQ Sbjct: 39 CATTLDKEPLRRQPPNSDTRRVTRPHSKQYLARQSAILQVQQSSDLESALTRLGGSLKVQ 98 Query: 258 DLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIGISRNPMK 410 DLN I+R+FG +RWH+L Q+F+WMQ+N +++ SYSS+IK++G S NP+K Sbjct: 99 DLNAIIRHFGMLKRWHDLSQLFEWMQQNGKISVSSYSSYIKFMGKSLNPVK 149 >ref|XP_008218792.1| PREDICTED: pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Prunus mume] Length = 664 Score = 84.0 bits (206), Expect = 4e-16 Identities = 37/67 (55%), Positives = 53/67 (79%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DLDS L+ G L+VQDLN I+R+FG +RWH+L Q+F+WMQ+N +++ SYSS+IK++G Sbjct: 86 DLDSALTRLGGSLKVQDLNAIIRHFGILKRWHDLSQLFEWMQQNGKISASSYSSYIKFMG 145 Query: 390 ISRNPMK 410 S NP+K Sbjct: 146 KSLNPVK 152 >ref|XP_021800676.1| pentatricopeptide repeat-containing protein At1g10910, chloroplastic [Prunus avium] Length = 681 Score = 84.0 bits (206), Expect = 4e-16 Identities = 37/67 (55%), Positives = 53/67 (79%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DLDS L+ G L+VQDLN I+R+FG +RWH+L Q+F+WMQ+N +++ SYSS+IK++G Sbjct: 103 DLDSALTRLGGSLKVQDLNAIIRHFGILKRWHDLSQLFEWMQQNGKISASSYSSYIKFMG 162 Query: 390 ISRNPMK 410 S NP+K Sbjct: 163 KSLNPVK 169 >ref|XP_007225150.2| pentatricopeptide repeat-containing protein At1g10910, chloroplastic isoform X1 [Prunus persica] gb|ONI36105.1| hypothetical protein PRUPE_1G569600 [Prunus persica] Length = 681 Score = 84.0 bits (206), Expect = 4e-16 Identities = 37/67 (55%), Positives = 53/67 (79%) Frame = +3 Query: 210 DLDSVLSGADGILQVQDLNFILRYFGESRRWHELCQVFDWMQKNNEVNFVSYSSFIKYIG 389 DLDS L+ G L+VQDLN I+R+FG +RWH+L Q+F+WMQ+N +++ SYSS+IK++G Sbjct: 103 DLDSALTRLGGSLKVQDLNAIIRHFGILKRWHDLSQLFEWMQQNGKISASSYSSYIKFMG 162 Query: 390 ISRNPMK 410 S NP+K Sbjct: 163 KSLNPVK 169