BLASTX nr result
ID: Ophiopogon23_contig00031689
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00031689 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK56931.1| uncharacterized protein A4U43_C10F14820 [Asparagu... 55 8e-07 >gb|ONK56931.1| uncharacterized protein A4U43_C10F14820 [Asparagus officinalis] Length = 99 Score = 55.1 bits (131), Expect = 8e-07 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -2 Query: 119 MLRLLCYGXXXXXXXXLPASADDIGFPRCNCDGDSLWTV 3 ML+LL YG LP+SA +IG+PRCNCDGDSLWTV Sbjct: 1 MLKLLFYGLLVSSLLLLPSSAIEIGYPRCNCDGDSLWTV 39