BLASTX nr result
ID: Ophiopogon23_contig00031599
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00031599 (680 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009412111.1| PREDICTED: importin subunit alpha-1b-like [M... 57 6e-06 ref|XP_020249584.1| serine/threonine-protein phosphatase PP1(5.9... 55 7e-06 gb|PKA57715.1| Importin subunit alpha-1 [Apostasia shenzhenica] 57 8e-06 >ref|XP_009412111.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. malaccensis] ref|XP_009412112.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. malaccensis] ref|XP_009412113.1| PREDICTED: importin subunit alpha-1b-like [Musa acuminata subsp. malaccensis] Length = 531 Score = 57.4 bits (137), Expect = 6e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 576 KSESWKPRKFEAAWALTNIASGTSENTKVVIDHG 677 K E + +FEAAWALTNIASGTSENTKVVIDHG Sbjct: 126 KREDYPQLQFEAAWALTNIASGTSENTKVVIDHG 159 >ref|XP_020249584.1| serine/threonine-protein phosphatase PP1(5.9)-like [Asparagus officinalis] Length = 187 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 582 ESWKPRKFEAAWALTNIASGTSENTKVVIDHG 677 E + +FEAAWALTNIASGTSENTKVVIDHG Sbjct: 126 EDFPQLQFEAAWALTNIASGTSENTKVVIDHG 157 >gb|PKA57715.1| Importin subunit alpha-1 [Apostasia shenzhenica] Length = 532 Score = 57.0 bits (136), Expect = 8e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 582 ESWKPRKFEAAWALTNIASGTSENTKVVIDHG 677 ES+ +FEAAWALTNIASGTSENTKVVIDHG Sbjct: 127 ESFPQLQFEAAWALTNIASGTSENTKVVIDHG 158