BLASTX nr result
ID: Ophiopogon23_contig00031545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00031545 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OVA01895.1| Elongation factor [Macleaya cordata] 62 4e-08 gb|AIU49434.1| translation initiation factor 2, partial [Yucca f... 60 2e-07 gb|AIU49443.1| translation initiation factor 2, partial [Platanu... 59 3e-07 gb|AIU49420.1| translation initiation factor 2, partial [Asparag... 59 4e-07 gb|AIU49405.1| translation initiation factor 2, partial [Sarcand... 59 4e-07 ref|XP_020245774.1| uncharacterized protein LOC109823804 [Aspara... 59 4e-07 gb|AIU49439.1| translation initiation factor 2, partial [Vitis v... 58 6e-07 ref|XP_002279490.2| PREDICTED: uncharacterized protein LOC100266... 58 6e-07 ref|XP_019176572.1| PREDICTED: uncharacterized protein LOC109171... 58 6e-07 gb|AIU49401.1| translation initiation factor 2, partial [Pinelli... 57 1e-06 gb|AIU49394.1| translation initiation factor 2, partial [Aquileg... 57 1e-06 gb|PIA64869.1| hypothetical protein AQUCO_00100382v1 [Aquilegia ... 57 1e-06 gb|AIU49425.1| translation initiation factor 2, partial [Erythra... 57 2e-06 gb|KZN07698.1| hypothetical protein DCAR_008535 [Daucus carota s... 57 2e-06 ref|XP_017236724.1| PREDICTED: translation initiation factor IF-... 57 2e-06 ref|XP_012838517.1| PREDICTED: translation initiation factor IF-... 57 2e-06 gb|EYU36043.1| hypothetical protein MIMGU_mgv1a001456mg [Erythra... 57 2e-06 gb|AIU49447.1| translation initiation factor 2, partial [Cabomba... 56 3e-06 gb|AIU49416.1| translation initiation factor 2, partial [Chloran... 56 4e-06 ref|XP_022881312.1| uncharacterized protein LOC111398578 isoform... 55 5e-06 >gb|OVA01895.1| Elongation factor [Macleaya cordata] Length = 782 Score = 61.6 bits (148), Expect = 4e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 QIGDIIHCLEQVNRKPKF+SSESGAVRI C Sbjct: 753 QIGDIIHCLEQVNRKPKFISSESGAVRIEC 782 >gb|AIU49434.1| translation initiation factor 2, partial [Yucca filamentosa] Length = 647 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 QIGD+I CLEQVNRKPKFVSS+SGAVRIVC Sbjct: 618 QIGDVIQCLEQVNRKPKFVSSDSGAVRIVC 647 >gb|AIU49443.1| translation initiation factor 2, partial [Platanus x hispanica] Length = 650 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 QIGDII CLEQVNRKPKFVSSESGAVRI C Sbjct: 621 QIGDIIQCLEQVNRKPKFVSSESGAVRIEC 650 >gb|AIU49420.1| translation initiation factor 2, partial [Asparagus officinalis] Length = 649 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 QIGD+I CLEQV RKPKFVSSESGAVRIVC Sbjct: 620 QIGDVIQCLEQVTRKPKFVSSESGAVRIVC 649 >gb|AIU49405.1| translation initiation factor 2, partial [Sarcandra glabra] Length = 650 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 Q+GDII CLEQVNRKPKFVSSESGAVRI C Sbjct: 621 QVGDIIQCLEQVNRKPKFVSSESGAVRIEC 650 >ref|XP_020245774.1| uncharacterized protein LOC109823804 [Asparagus officinalis] gb|ONK57867.1| uncharacterized protein A4U43_C09F5020 [Asparagus officinalis] Length = 715 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 QIGD+I CLEQV RKPKFVSSESGAVRIVC Sbjct: 686 QIGDVIQCLEQVTRKPKFVSSESGAVRIVC 715 >gb|AIU49439.1| translation initiation factor 2, partial [Vitis vinifera] Length = 650 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 QIGD+I CLEQVNRKPKF+SSESGAVRI C Sbjct: 621 QIGDVIQCLEQVNRKPKFISSESGAVRIEC 650 >ref|XP_002279490.2| PREDICTED: uncharacterized protein LOC100266672 [Vitis vinifera] ref|XP_019080883.1| PREDICTED: uncharacterized protein LOC100266672 [Vitis vinifera] emb|CBI39516.3| unnamed protein product, partial [Vitis vinifera] Length = 725 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 QIGD+I CLEQVNRKPKF+SSESGAVRI C Sbjct: 696 QIGDVIQCLEQVNRKPKFISSESGAVRIEC 725 >ref|XP_019176572.1| PREDICTED: uncharacterized protein LOC109171927 [Ipomoea nil] ref|XP_019176573.1| PREDICTED: uncharacterized protein LOC109171927 [Ipomoea nil] Length = 732 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 Q+GDII CLEQVNRKPKF+SSESGAVRI C Sbjct: 703 QVGDIIQCLEQVNRKPKFISSESGAVRIEC 732 >gb|AIU49401.1| translation initiation factor 2, partial [Pinellia ternata] Length = 618 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 ++GDII CLEQVNRKPKFVSSESGAVRI C Sbjct: 589 RVGDIIQCLEQVNRKPKFVSSESGAVRIEC 618 >gb|AIU49394.1| translation initiation factor 2, partial [Aquilegia coerulea] Length = 648 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 QIGDII CLE+VNRKPKF+SSESGAVRI C Sbjct: 619 QIGDIIQCLEKVNRKPKFISSESGAVRIEC 648 >gb|PIA64869.1| hypothetical protein AQUCO_00100382v1 [Aquilegia coerulea] gb|PIA64870.1| hypothetical protein AQUCO_00100382v1 [Aquilegia coerulea] Length = 716 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 QIGDII CLE+VNRKPKF+SSESGAVRI C Sbjct: 687 QIGDIIQCLEKVNRKPKFISSESGAVRIEC 716 >gb|AIU49425.1| translation initiation factor 2, partial [Erythranthe guttata] Length = 650 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 Q+GD+I CLE+VNRKPKFVSSESGAVRI C Sbjct: 621 QVGDVIQCLEKVNRKPKFVSSESGAVRIEC 650 >gb|KZN07698.1| hypothetical protein DCAR_008535 [Daucus carota subsp. sativus] Length = 652 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 Q+GD+I CLEQVNR+PKF+SSESGAVRI C Sbjct: 623 QVGDVIQCLEQVNRRPKFISSESGAVRIEC 652 >ref|XP_017236724.1| PREDICTED: translation initiation factor IF-2 [Daucus carota subsp. sativus] Length = 718 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 Q+GD+I CLEQVNR+PKF+SSESGAVRI C Sbjct: 689 QVGDVIQCLEQVNRRPKFISSESGAVRIEC 718 >ref|XP_012838517.1| PREDICTED: translation initiation factor IF-2, mitochondrial [Erythranthe guttata] Length = 740 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 Q+GD+I CLE+VNRKPKFVSSESGAVRI C Sbjct: 711 QVGDVIQCLEKVNRKPKFVSSESGAVRIEC 740 >gb|EYU36043.1| hypothetical protein MIMGU_mgv1a001456mg [Erythranthe guttata] Length = 816 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 Q+GD+I CLE+VNRKPKFVSSESGAVRI C Sbjct: 787 QVGDVIQCLEKVNRKPKFVSSESGAVRIEC 816 >gb|AIU49447.1| translation initiation factor 2, partial [Cabomba caroliniana] Length = 625 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 QIGDII CLE VNRKPKFVSSESGAVRI C Sbjct: 596 QIGDIIQCLELVNRKPKFVSSESGAVRIEC 625 >gb|AIU49416.1| translation initiation factor 2, partial [Chloranthus japonicus] Length = 650 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 ++GDII CLEQVN+KPKFVSSESGAVRI C Sbjct: 621 RVGDIIQCLEQVNKKPKFVSSESGAVRIEC 650 >ref|XP_022881312.1| uncharacterized protein LOC111398578 isoform X2 [Olea europaea var. sylvestris] Length = 731 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 QIGDIIHCLEQVNRKPKFVSSESGAVRIVC 92 Q+GD+I CL QVNRKPKFVSSESGAVRI C Sbjct: 702 QVGDVIQCLVQVNRKPKFVSSESGAVRIEC 731