BLASTX nr result
ID: Ophiopogon23_contig00031031
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00031031 (1037 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_039456761.1| hypothetical protein [Candidatus Jidaibacter... 79 2e-12 gb|KIE05185.1| hypothetical protein NF27_EM00110 [Candidatus Jid... 79 2e-12 ref|WP_040010503.1| hypothetical protein [Francisella sp. FSC100... 76 2e-11 gb|ABK89085.1| hypothetical protein FTN_0175 [Francisella novici... 69 6e-09 gb|ABB76140.1| 58-kDa secreted protein [Francisella novicida] >g... 69 6e-09 ref|WP_057113141.1| hypothetical protein [Francisella tularensis... 68 7e-09 ref|WP_025329578.1| hypothetical protein [Francisella tularensis] 68 7e-09 ref|WP_003027400.1| hypothetical protein [Francisella tularensis... 68 7e-09 ref|WP_003017499.1| hypothetical protein [Francisella tularensis... 68 7e-09 gb|ABO47541.1| hypothetical protein FTW_1892 [Francisella tulare... 68 7e-09 ref|WP_064005493.1| hypothetical protein [Piscirickettsiaceae ba... 67 2e-08 ref|WP_010031874.1| hypothetical protein [Francisella tularensis... 64 2e-07 ref|WP_085180368.1| hypothetical protein [Francisella tularensis... 64 2e-07 ref|WP_003017460.1| hypothetical protein [Francisella tularensis... 64 2e-07 ref|WP_011648791.1| hypothetical protein [Francisella tularensis... 64 2e-07 >ref|WP_039456761.1| hypothetical protein [Candidatus Jidaibacter acanthamoeba] Length = 547 Score = 79.3 bits (194), Expect = 2e-12 Identities = 59/209 (28%), Positives = 104/209 (49%), Gaps = 10/209 (4%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDNVF---ECTVDSVESCLEISRNMLRYANQDFSSQIQ-NNDKVYVS 869 GDP+QLS+I N + C + ++++C++ + +L YA DFS+QI N+ Sbjct: 229 GDPSQLSRILNKDSSGKYYALTCDLKAMDNCIKAASGLLDYAVNDFSTQISFKNNTGLTP 288 Query: 868 MGIEDATLIPITQLNLNW-KSLVTEEIRENREKLVAILNENEYYVGKLYPFVQGGYPVDL 692 +G A I + L K+LV + E+R L +L N+ Y + YPV Sbjct: 289 LGTGFAHSEKIDHIGLTPPKTLVNSTVIEDRNLLSELLETNKSYQQYSDQLINH-YPVTW 347 Query: 691 HPDFK--KSLNVLSKKVDKNI-KVLRRN--TNGAIECWNNLERCSYAVQRINADIRKIGS 527 + + K K++ K+++ NI K+L N + A+ C++N E C + Q I D+ I + Sbjct: 348 NTNSKLYKNIKTFEKEIEYNIGKILNYNDPSESALGCFDNPEECDFITQNIVNDLVNITN 407 Query: 526 KDLDIFKPIEFMFSAKLSRFYKLNKQDTF 440 DL K I++ F ++ YK ++++ Sbjct: 408 TDLAFLKAIKYTFPLCIANLYKNGDENSW 436 >gb|KIE05185.1| hypothetical protein NF27_EM00110 [Candidatus Jidaibacter acanthamoeba] Length = 555 Score = 79.3 bits (194), Expect = 2e-12 Identities = 59/209 (28%), Positives = 104/209 (49%), Gaps = 10/209 (4%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDNVF---ECTVDSVESCLEISRNMLRYANQDFSSQIQ-NNDKVYVS 869 GDP+QLS+I N + C + ++++C++ + +L YA DFS+QI N+ Sbjct: 237 GDPSQLSRILNKDSSGKYYALTCDLKAMDNCIKAASGLLDYAVNDFSTQISFKNNTGLTP 296 Query: 868 MGIEDATLIPITQLNLNW-KSLVTEEIRENREKLVAILNENEYYVGKLYPFVQGGYPVDL 692 +G A I + L K+LV + E+R L +L N+ Y + YPV Sbjct: 297 LGTGFAHSEKIDHIGLTPPKTLVNSTVIEDRNLLSELLETNKSYQQYSDQLINH-YPVTW 355 Query: 691 HPDFK--KSLNVLSKKVDKNI-KVLRRN--TNGAIECWNNLERCSYAVQRINADIRKIGS 527 + + K K++ K+++ NI K+L N + A+ C++N E C + Q I D+ I + Sbjct: 356 NTNSKLYKNIKTFEKEIEYNIGKILNYNDPSESALGCFDNPEECDFITQNIVNDLVNITN 415 Query: 526 KDLDIFKPIEFMFSAKLSRFYKLNKQDTF 440 DL K I++ F ++ YK ++++ Sbjct: 416 TDLAFLKAIKYTFPLCIANLYKNGDENSW 444 >ref|WP_040010503.1| hypothetical protein [Francisella sp. FSC1006] gb|AIT10129.1| hypothetical protein LO80_09195 [Francisella sp. FSC1006] Length = 555 Score = 75.9 bits (185), Expect = 2e-11 Identities = 54/204 (26%), Positives = 98/204 (48%), Gaps = 14/204 (6%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQD-------FSSQIQ- 893 G P +L++I + D C++ +++ C++ + +L YA FS Q Sbjct: 237 GKPERLAEILSKDPDKGGYYALTCSMQNMDRCIKAAEGVLDYAGSKETHATDGFSKQYDL 296 Query: 892 NNDKVYVSMGIEDATLIPITQLNLNWK-SLVTEEIRENREKLVAILNENEYYVGKLYPFV 716 + D+ GI A + I + L+ +LVT +++E R+KL L ENEYY L + Sbjct: 297 SKDENLEPFGIAFADTMDIELIGLDEPDTLVTPQVKEARKKLENDLKENEYYKEHLGAII 356 Query: 715 QGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERCSYAVQRINADIRK 536 G YPV L +K+ L L K D N+ L +G I+C+ +C Q + + ++ Sbjct: 357 NG-YPVKLDDQYKEKLEDLYTKADDNVNTLTNPVSGGIQCFTKPYKCISVAQDLESKLKP 415 Query: 535 IGSKDL-DIFKPIEFMFSAKLSRF 467 I +++ D + I++ + +R+ Sbjct: 416 ITDEEITDSLESIKYNIKSNSNRW 439 >gb|ABK89085.1| hypothetical protein FTN_0175 [Francisella novicida U112] gb|AJI61476.1| hypothetical protein AW25_25 [Francisella tularensis subsp. novicida U112] Length = 541 Score = 68.6 bits (166), Expect = 6e-09 Identities = 55/223 (24%), Positives = 105/223 (47%), Gaps = 26/223 (11%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQDFSSQIQ----NNDK 881 GDPT+L+ IF D+N C ++ + +C N++ YA ++ + + NND+ Sbjct: 226 GDPTKLANIFGEPDENGVYKATSCNLNDLSACNSAIGNIITYAKGEYQNSLDNAFANNDQ 285 Query: 880 ---------------VYVSMGIEDATLIPITQLNLNWKSLVTEEIRENREKLVAILNENE 746 ++ +GIE T IP + N+ ++I++ RE++V+ N+ Sbjct: 286 SKLKLLLGDRDDYFDLHSVIGIEPGTDIPEVK-NI-------DQIKQARERMVSAYLANK 337 Query: 745 YYVGKLYPFVQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERC-SY 569 YYV K + YP++L +K +L K N+ +++ C+NNL+ C S Sbjct: 338 YYVDKANKIFK-TYPIELDDSYKIALGQFMDKAQANVNLIQEKI--VKNCYNNLQNCPSV 394 Query: 568 AVQRINADIRKIGSKDL--DIFKPIEFMFSAKLSRFYKLNKQD 446 A Q + + ++DL I PI++ + L+ + ++ +D Sbjct: 395 ASQVLTSSNPNAITEDLVDKINAPIKYAYRGYLTDYGPISSKD 437 >gb|ABB76140.1| 58-kDa secreted protein [Francisella novicida] gb|EDX18851.1| hypothetical protein FTE_0068 [Francisella tularensis subsp. novicida FTE] Length = 554 Score = 68.6 bits (166), Expect = 6e-09 Identities = 55/223 (24%), Positives = 105/223 (47%), Gaps = 26/223 (11%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQDFSSQIQ----NNDK 881 GDPT+L+ IF D+N C ++ + +C N++ YA ++ + + NND+ Sbjct: 239 GDPTKLANIFGEPDENGVYKATSCNLNDLSACNSAIGNIITYAKGEYQNSLDNAFANNDQ 298 Query: 880 ---------------VYVSMGIEDATLIPITQLNLNWKSLVTEEIRENREKLVAILNENE 746 ++ +GIE T IP + N+ ++I++ RE++V+ N+ Sbjct: 299 SKLKLLLGDRDDYFDLHSVIGIEPGTDIPEVK-NI-------DQIKQARERMVSAYLANK 350 Query: 745 YYVGKLYPFVQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERC-SY 569 YYV K + YP++L +K +L K N+ +++ C+NNL+ C S Sbjct: 351 YYVDKANKIFK-TYPIELDDSYKIALGQFMDKAQANVNLIQEKI--VKNCYNNLQNCPSV 407 Query: 568 AVQRINADIRKIGSKDL--DIFKPIEFMFSAKLSRFYKLNKQD 446 A Q + + ++DL I PI++ + L+ + ++ +D Sbjct: 408 ASQVLTSSNPNAITEDLVDKINAPIKYAYRGYLTDYGPISSKD 450 >ref|WP_057113141.1| hypothetical protein [Francisella tularensis] gb|ALK93966.1| hypothetical protein ADP75_04580 [Francisella tularensis] Length = 465 Score = 68.2 bits (165), Expect = 7e-09 Identities = 56/223 (25%), Positives = 104/223 (46%), Gaps = 26/223 (11%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQDFSSQIQ----NNDK 881 GDPT+L+ IF D+N C ++ + +C N++ YA ++ + + NND+ Sbjct: 226 GDPTKLANIFGEPDENGIYKATSCNLNDLSACNSAIGNIITYAKGEYQNSLDNAFANNDQ 285 Query: 880 ---------------VYVSMGIEDATLIPITQLNLNWKSLVTEEIRENREKLVAILNENE 746 ++ +GIE T IP + N+ ++I++ RE++V+ N+ Sbjct: 286 SKLKLLLGDRDDYFDLHSVIGIEPGTDIPEVK-NI-------DQIKQARERMVSAYLANK 337 Query: 745 YYVGKLYPFVQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERC-SY 569 YYV K + YPV L +K +L K N+ +++ C+NNL+ C S Sbjct: 338 YYVDKANKIFK-TYPVTLDDSYKIALGQFMDKAQANVNLIQEKI--VKNCYNNLQNCPSV 394 Query: 568 AVQRINADIRKIGSKDL--DIFKPIEFMFSAKLSRFYKLNKQD 446 A Q + + ++DL I PI++ + L+ + ++ +D Sbjct: 395 ASQVLTSSNPNAITEDLVDKINAPIKYAYRGYLTDYGPISSED 437 >ref|WP_025329578.1| hypothetical protein [Francisella tularensis] Length = 465 Score = 68.2 bits (165), Expect = 7e-09 Identities = 56/223 (25%), Positives = 104/223 (46%), Gaps = 26/223 (11%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQDFSSQIQ----NNDK 881 GDPT+L+ IF D+N C ++ + +C N++ YA ++ + + NND+ Sbjct: 226 GDPTKLANIFGEPDENGIYKATSCNLNDLSACNSAIGNIITYAKGEYQNSLDNAFANNDQ 285 Query: 880 ---------------VYVSMGIEDATLIPITQLNLNWKSLVTEEIRENREKLVAILNENE 746 ++ +GIE T IP + N+ ++I++ RE++V+ N+ Sbjct: 286 SKLKLLLGDRDDYFDLHSVIGIEPGTDIPEVK-NI-------DQIKQARERMVSAYLANK 337 Query: 745 YYVGKLYPFVQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERC-SY 569 YYV K + YPV L +K +L K N+ +++ C+NNL+ C S Sbjct: 338 YYVDKANKIFK-TYPVTLDDSYKIALGQFMDKAQANVNLIQEKI--VKNCYNNLQNCPSV 394 Query: 568 AVQRINADIRKIGSKDL--DIFKPIEFMFSAKLSRFYKLNKQD 446 A Q + + ++DL I PI++ + L+ + ++ +D Sbjct: 395 ASQVLTSSNPNAITEDLVDKINAPIKYAYRGYLTDYGPISSED 437 >ref|WP_003027400.1| hypothetical protein [Francisella tularensis] gb|EKM84670.1| hypothetical protein B344_09464 [Francisella tularensis subsp. tularensis 831] gb|EKM84814.1| hypothetical protein B345_09527 [Francisella tularensis subsp. tularensis AS_713] gb|EKM89653.1| hypothetical protein B341_09497 [Francisella tularensis subsp. tularensis 70102010] gb|EKM90081.1| hypothetical protein B342_09555 [Francisella tularensis subsp. tularensis 80700103] gb|EKT89078.1| hypothetical protein B229_09465 [Francisella tularensis subsp. tularensis 70001275] gb|EMI58735.1| hypothetical protein H642_09535 [Francisella tularensis subsp. tularensis 3571] gb|KFJ64748.1| putative 58-kDa secreted protein [Francisella tularensis] gb|AJI64001.1| hypothetical protein CH65_307 [Francisella tularensis subsp. tularensis] gb|AKH92713.1| hypothetical protein FT4114_09210 [Francisella tularensis subsp. tularensis WY-00W4114] gb|AKU74219.1| hypothetical protein ACX55_805 [Francisella tularensis subsp. tularensis] Length = 465 Score = 68.2 bits (165), Expect = 7e-09 Identities = 56/223 (25%), Positives = 104/223 (46%), Gaps = 26/223 (11%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQDFSSQIQ----NNDK 881 GDPT+L+ IF D+N C ++ + +C N++ YA ++ + + NND+ Sbjct: 226 GDPTKLANIFGEPDENGVYKATSCNLNDLSACNSAIGNIITYAKGEYQNSLDNAFANNDQ 285 Query: 880 ---------------VYVSMGIEDATLIPITQLNLNWKSLVTEEIRENREKLVAILNENE 746 ++ +GIE T IP + N+ ++I++ RE++V+ N+ Sbjct: 286 SKLKLLLGDRDDYFDLHSVIGIEPGTDIPEVK-NI-------DQIKQARERMVSAYLANK 337 Query: 745 YYVGKLYPFVQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERC-SY 569 YYV K + YPV L +K +L K N+ +++ C+NNL+ C S Sbjct: 338 YYVDKANKIFK-TYPVTLDDSYKIALGQFMDKAQANVNLIQEKI--VKNCYNNLQNCPSV 394 Query: 568 AVQRINADIRKIGSKDL--DIFKPIEFMFSAKLSRFYKLNKQD 446 A Q + + ++DL I PI++ + L+ + ++ +D Sbjct: 395 ASQVLTSSNPNAITEDLVDKINAPIKYAYRGYLTDYGPISSED 437 >ref|WP_003017499.1| hypothetical protein [Francisella tularensis] gb|EDO65490.1| hypothetical protein FTAG_01226 [Francisella tularensis subsp. holarctica FSC022] gb|KIP31282.1| hypothetical protein CH66_1185 [Francisella tularensis subsp. holarctica] gb|OCQ62208.1| hypothetical protein ASZ94_08780 [Francisella tularensis] gb|OPH24012.1| hypothetical protein BSY87_03370 [Francisella tularensis subsp. holarctica FSC022] Length = 465 Score = 68.2 bits (165), Expect = 7e-09 Identities = 56/223 (25%), Positives = 104/223 (46%), Gaps = 26/223 (11%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQDFSSQIQ----NNDK 881 GDPT+L+ IF D+N C ++ + +C N++ YA ++ + + NND+ Sbjct: 226 GDPTKLANIFGEPDENGIYKATSCNLNDLSACNSAIGNIITYAKGEYQNSLDNAFANNDQ 285 Query: 880 ---------------VYVSMGIEDATLIPITQLNLNWKSLVTEEIRENREKLVAILNENE 746 ++ +GIE T IP + N+ ++I++ RE++V+ N+ Sbjct: 286 SKLKLLLGDRDDYFDLHSVIGIEPGTDIPEVK-NI-------DQIKQARERMVSAYLANK 337 Query: 745 YYVGKLYPFVQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERC-SY 569 YYV K + YPV L +K +L K N+ +++ C+NNL+ C S Sbjct: 338 YYVDKANKIFK-TYPVTLDDSYKIALGQFMDKAQANVNLIQEKI--VKNCYNNLQNCPSV 394 Query: 568 AVQRINADIRKIGSKDL--DIFKPIEFMFSAKLSRFYKLNKQD 446 A Q + + ++DL I PI++ + L+ + ++ +D Sbjct: 395 ASQVLTSSNPNAITEDLVDKINAPIKYAYRGYLTDYGPISSED 437 >gb|ABO47541.1| hypothetical protein FTW_1892 [Francisella tularensis subsp. tularensis WY96-3418] Length = 478 Score = 68.2 bits (165), Expect = 7e-09 Identities = 56/223 (25%), Positives = 104/223 (46%), Gaps = 26/223 (11%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQDFSSQIQ----NNDK 881 GDPT+L+ IF D+N C ++ + +C N++ YA ++ + + NND+ Sbjct: 239 GDPTKLANIFGEPDENGVYKATSCNLNDLSACNSAIGNIITYAKGEYQNSLDNAFANNDQ 298 Query: 880 ---------------VYVSMGIEDATLIPITQLNLNWKSLVTEEIRENREKLVAILNENE 746 ++ +GIE T IP + N+ ++I++ RE++V+ N+ Sbjct: 299 SKLKLLLGDRDDYFDLHSVIGIEPGTDIPEVK-NI-------DQIKQARERMVSAYLANK 350 Query: 745 YYVGKLYPFVQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERC-SY 569 YYV K + YPV L +K +L K N+ +++ C+NNL+ C S Sbjct: 351 YYVDKANKIFK-TYPVTLDDSYKIALGQFMDKAQANVNLIQEKI--VKNCYNNLQNCPSV 407 Query: 568 AVQRINADIRKIGSKDL--DIFKPIEFMFSAKLSRFYKLNKQD 446 A Q + + ++DL I PI++ + L+ + ++ +D Sbjct: 408 ASQVLTSSNPNAITEDLVDKINAPIKYAYRGYLTDYGPISSED 450 >ref|WP_064005493.1| hypothetical protein [Piscirickettsiaceae bacterium NZ-RLO] gb|OAJ34090.1| hypothetical protein A0O36_01690 [Piscirickettsiaceae bacterium NZ-RLO] Length = 539 Score = 67.0 bits (162), Expect = 2e-08 Identities = 47/202 (23%), Positives = 93/202 (46%), Gaps = 14/202 (6%) Frame = -2 Query: 1036 GDPTQLSKIF---NSADDNVFECTVDSVESCLEISRNMLRYANQD-------FSSQ---I 896 GDP+ L KI ++ D C++ ++ SC++ + ML YA+ F++Q + Sbjct: 232 GDPSNLGKILGKDSNGDYYALTCSLKNMSSCVKTAGAMLDYASSQGVHSKDGFTTQYSIV 291 Query: 895 QNNDKVYVSMGIEDATLIPITQLNLNWK-SLVTEEIRENREKLVAILNENEYYVGKLYPF 719 N + +G D + + +LN +LVT ++ R KL + + +YY + + Sbjct: 292 DNKNLQPFDLGFADLSPVKYILYSLNIPPTLVTPAVQAARIKLAGDMKKYDYY-SERFNR 350 Query: 718 VQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERCSYAVQRINADIR 539 + YP L + L + + NI ++ T+G ++C+ + C V +I + Sbjct: 351 LYSNYPTPLTSSSLNAAKALLDRANNNIAIMSNQTSGGMKCFTQPDTCPDTVNQIEGSMT 410 Query: 538 KIGSKDLDIFKPIEFMFSAKLS 473 I + DL + ++++SA S Sbjct: 411 PITNNDLSAWSQFKYIYSAPKS 432 >ref|WP_010031874.1| hypothetical protein [Francisella tularensis] gb|AFX71504.1| hypothetical protein F92_10490 [Francisella tularensis subsp. holarctica F92] gb|KHS54949.1| hypothetical protein RB23_03370 [Francisella tularensis subsp. holarctica] gb|AJI67283.1| hypothetical protein CH68_2052 [Francisella tularensis subsp. holarctica] gb|AKO67973.1| hypothetical protein AAX59_00930 [Francisella tularensis subsp. holarctica] gb|KXO26316.1| hypothetical protein IU42_04090 [Francisella tularensis] gb|KXO32668.1| hypothetical protein IU43_04095 [Francisella tularensis] gb|KXO37628.1| hypothetical protein IU39_03970 [Francisella tularensis] gb|KXO47721.1| hypothetical protein HN53_03970 [Francisella tularensis] gb|KXO49529.1| hypothetical protein IX98_03960 [Francisella tularensis] gb|KXO52606.1| hypothetical protein IY00_03960 [Francisella tularensis] gb|KXO57747.1| hypothetical protein IY03_04085 [Francisella tularensis] gb|KXO59724.1| hypothetical protein IX99_04085 [Francisella tularensis] gb|KXO61472.1| hypothetical protein IY01_03960 [Francisella tularensis] gb|KXO64513.1| hypothetical protein IX97_04085 [Francisella tularensis] gb|OPH41078.1| hypothetical protein BS308_04470 [Francisella tularensis subsp. holarctica] gb|OPH42750.1| hypothetical protein BS307_03775 [Francisella tularensis subsp. holarctica] gb|OPH44346.1| hypothetical protein BS320_03780 [Francisella tularensis subsp. holarctica] gb|OPH45899.1| hypothetical protein BS317_03710 [Francisella tularensis subsp. holarctica] gb|ORU05900.1| hypothetical protein ACC95_02840 [Francisella tularensis subsp. holarctica] gb|ORU06398.1| hypothetical protein ACC94_09980 [Francisella tularensis subsp. holarctica] gb|ORU08611.1| hypothetical protein ACB98_06580 [Francisella tularensis subsp. holarctica] gb|ORU10087.1| hypothetical protein ACC92_08015 [Francisella tularensis subsp. holarctica] gb|ORU12094.1| hypothetical protein ACC90_06145 [Francisella tularensis subsp. holarctica] gb|ORU14387.1| hypothetical protein ACC91_02360 [Francisella tularensis subsp. holarctica] gb|ORU15865.1| hypothetical protein ACC89_03925 [Francisella tularensis subsp. holarctica] gb|ORU16678.1| hypothetical protein ACC88_08945 [Francisella tularensis subsp. holarctica] gb|ORU19332.1| hypothetical protein ACC86_03040 [Francisella tularensis subsp. holarctica] gb|ORU21239.1| hypothetical protein ACC85_01765 [Francisella tularensis subsp. holarctica] gb|ORU22194.1| hypothetical protein ACC87_07885 [Francisella tularensis subsp. holarctica] gb|ORU25234.1| hypothetical protein ACC83_08480 [Francisella tularensis subsp. holarctica] gb|ORU26812.1| hypothetical protein ACC84_09110 [Francisella tularensis subsp. holarctica] gb|ORU28416.1| hypothetical protein ACC82_08935 [Francisella tularensis subsp. holarctica] gb|ORU30744.1| hypothetical protein ACC80_03845 [Francisella tularensis subsp. holarctica] gb|ORU32567.1| hypothetical protein ACC81_04075 [Francisella tularensis subsp. holarctica] gb|ORU34971.1| hypothetical protein ACC78_04545 [Francisella tularensis subsp. holarctica] gb|ORU35315.1| hypothetical protein ACC79_02705 [Francisella tularensis subsp. holarctica] gb|ORU37869.1| hypothetical protein ACC76_01220 [Francisella tularensis subsp. holarctica] gb|ORU39778.1| hypothetical protein ACC77_06800 [Francisella tularensis subsp. holarctica] gb|ORU40068.1| hypothetical protein ACC72_03905 [Francisella tularensis subsp. holarctica] gb|ORU42508.1| hypothetical protein ACC75_00295 [Francisella tularensis subsp. holarctica] gb|ORU43844.1| hypothetical protein ACC71_03260 [Francisella tularensis subsp. holarctica] gb|ORU44830.1| hypothetical protein ACC73_06590 [Francisella tularensis subsp. holarctica] gb|ORU45978.1| hypothetical protein ACC74_07005 [Francisella tularensis subsp. holarctica] gb|ORU48525.1| hypothetical protein ACC68_08320 [Francisella tularensis subsp. holarctica] gb|ORU48573.1| hypothetical protein ACC70_04420 [Francisella tularensis subsp. holarctica] gb|ORU49473.1| hypothetical protein ACC69_08165 [Francisella tularensis subsp. holarctica] gb|ORU53129.1| hypothetical protein ACC67_04595 [Francisella tularensis subsp. holarctica] gb|ORU55190.1| hypothetical protein ACC66_01560 [Francisella tularensis subsp. holarctica] gb|ORU55840.1| hypothetical protein ACC65_06810 [Francisella tularensis subsp. holarctica] gb|ORU58359.1| hypothetical protein ACC64_04425 [Francisella tularensis subsp. holarctica] gb|ORU58909.1| hypothetical protein ACC63_04165 [Francisella tularensis subsp. holarctica] gb|ORU60360.1| hypothetical protein ACC62_08200 [Francisella tularensis subsp. holarctica] gb|ORU62029.1| hypothetical protein ACC60_07810 [Francisella tularensis subsp. holarctica] gb|ORU64142.1| hypothetical protein ACC61_04730 [Francisella tularensis subsp. holarctica] gb|ORU66229.1| hypothetical protein ACC59_01600 [Francisella tularensis subsp. holarctica] gb|ORU66899.1| hypothetical protein ACC58_06970 [Francisella tularensis subsp. holarctica] gb|ORU68345.1| hypothetical protein ACC56_08255 [Francisella tularensis subsp. holarctica] gb|ORU72504.1| hypothetical protein ACC52_00970 [Francisella tularensis subsp. holarctica] gb|ORU73948.1| hypothetical protein ACC49_06885 [Francisella tularensis subsp. holarctica] gb|ORU75931.1| hypothetical protein ACC51_00660 [Francisella tularensis subsp. holarctica] gb|ORU77627.1| hypothetical protein ACC55_02170 [Francisella tularensis subsp. holarctica] gb|ORU78160.1| hypothetical protein ACC48_08175 [Francisella tularensis subsp. holarctica] gb|ORU79600.1| hypothetical protein ACC47_09150 [Francisella tularensis subsp. holarctica] gb|ORU81680.1| hypothetical protein ACC46_07090 [Francisella tularensis subsp. holarctica] gb|ORU82883.1| hypothetical protein ACC45_10135 [Francisella tularensis subsp. holarctica] gb|ORU85767.1| hypothetical protein ACC44_02580 [Francisella tularensis subsp. holarctica] gb|ORU86726.1| hypothetical protein ACC43_06555 [Francisella tularensis subsp. holarctica] gb|PLQ18174.1| hypothetical protein CYR01_03900 [Francisella tularensis subsp. holarctica] gb|PLQ20081.1| hypothetical protein CYR05_03900 [Francisella tularensis subsp. holarctica] gb|PLQ20551.1| hypothetical protein CYR06_03820 [Francisella tularensis subsp. holarctica] gb|PLQ24561.1| hypothetical protein CYR09_03930 [Francisella tularensis subsp. holarctica] gb|PLQ26060.1| hypothetical protein CYR07_03935 [Francisella tularensis subsp. holarctica] gb|PLQ28030.1| hypothetical protein CYR15_03930 [Francisella tularensis subsp. holarctica] gb|PLQ32849.1| hypothetical protein CYR12_03930 [Francisella tularensis subsp. holarctica] gb|PLQ33682.1| hypothetical protein CYR10_03930 [Francisella tularensis subsp. holarctica] gb|PLQ36508.1| hypothetical protein CYR14_03935 [Francisella tularensis subsp. holarctica] gb|PLQ37497.1| hypothetical protein CYR20_03930 [Francisella tularensis subsp. holarctica] gb|PLQ38897.1| hypothetical protein CYR13_03815 [Francisella tularensis subsp. holarctica] gb|PLQ41007.1| hypothetical protein CYR17_03840 [Francisella tularensis subsp. holarctica] gb|PLQ42956.1| hypothetical protein CYR18_03930 [Francisella tularensis subsp. holarctica] gb|PLQ43342.1| hypothetical protein CYR16_03900 [Francisella tularensis subsp. holarctica] gb|PLQ45518.1| hypothetical protein CYR19_03900 [Francisella tularensis subsp. holarctica] gb|PLQ48099.1| hypothetical protein CYR26_03900 [Francisella tularensis subsp. holarctica] gb|PLQ48372.1| hypothetical protein CYR29_03845 [Francisella tularensis subsp. holarctica] gb|PLQ50511.1| hypothetical protein CYR25_03840 [Francisella tularensis subsp. holarctica] gb|PLQ52769.1| hypothetical protein CYR27_03845 [Francisella tularensis subsp. holarctica] gb|PLQ53594.1| hypothetical protein CYR37_03835 [Francisella tularensis subsp. holarctica] gb|PLQ55323.1| hypothetical protein CYR30_03725 [Francisella tularensis subsp. holarctica] gb|PLQ57225.1| hypothetical protein CYR50_03760 [Francisella tularensis subsp. holarctica] gb|PLQ58855.1| hypothetical protein CYR33_03760 [Francisella tularensis subsp. holarctica] gb|PLQ60047.1| hypothetical protein CYR41_03780 [Francisella tularensis subsp. holarctica] gb|PLQ61920.1| hypothetical protein CYR46_03760 [Francisella tularensis subsp. holarctica] gb|PLQ63362.1| hypothetical protein CYR35_03725 [Francisella tularensis subsp. holarctica] gb|PLQ64744.1| hypothetical protein CYR36_03730 [Francisella tularensis subsp. holarctica] gb|PLQ66752.1| hypothetical protein CYR39_03730 [Francisella tularensis subsp. holarctica] gb|PLQ68074.1| hypothetical protein CYR44_03835 [Francisella tularensis subsp. holarctica] gb|PLQ69571.1| hypothetical protein CYR43_03840 [Francisella tularensis subsp. holarctica] gb|PLQ72764.1| hypothetical protein CYR47_03775 [Francisella tularensis subsp. holarctica] gb|PLQ76394.1| hypothetical protein CYR54_03720 [Francisella tularensis subsp. holarctica] gb|PLQ77636.1| hypothetical protein CYR57_03785 [Francisella tularensis subsp. holarctica] gb|PLQ79180.1| hypothetical protein CYR62_03775 [Francisella tularensis subsp. holarctica] gb|PLQ80980.1| hypothetical protein CYR56_03775 [Francisella tularensis subsp. holarctica] gb|PLQ82507.1| hypothetical protein CYR64_03775 [Francisella tularensis subsp. holarctica] gb|PLQ84091.1| hypothetical protein CYR67_03900 [Francisella tularensis subsp. holarctica] gb|PLQ85661.1| hypothetical protein CYR58_03825 [Francisella tularensis subsp. holarctica] gb|PLQ87392.1| hypothetical protein CYR70_03900 [Francisella tularensis subsp. holarctica] gb|PLQ88926.1| hypothetical protein CYR60_03895 [Francisella tularensis subsp. holarctica] gb|PLQ90919.1| hypothetical protein CYR63_02955 [Francisella tularensis subsp. holarctica] gb|PLQ92266.1| hypothetical protein CYR61_03900 [Francisella tularensis subsp. holarctica] gb|PLQ93851.1| hypothetical protein CYR66_03900 [Francisella tularensis subsp. holarctica] gb|PLQ95571.1| hypothetical protein CYR68_03900 [Francisella tularensis subsp. holarctica] gb|PLQ97045.1| hypothetical protein CYR65_03900 [Francisella tularensis subsp. holarctica] gb|PLQ99056.1| hypothetical protein CYR71_03260 [Francisella tularensis subsp. holarctica] gb|PLR00865.1| hypothetical protein CYR59_02515 [Francisella tularensis subsp. holarctica] gb|PLR01747.1| hypothetical protein CYR72_03890 [Francisella tularensis subsp. holarctica] gb|PLR03457.1| hypothetical protein CYR69_03900 [Francisella tularensis subsp. holarctica] gb|PLR04966.1| hypothetical protein CYR73_03930 [Francisella tularensis subsp. holarctica] gb|AUP76049.1| hypothetical protein CYL81_09390 [Francisella tularensis] Length = 462 Score = 63.9 bits (154), Expect = 2e-07 Identities = 55/223 (24%), Positives = 103/223 (46%), Gaps = 26/223 (11%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQDFSSQIQ----NNDK 881 GDPT+L+ IF D+N C ++ + +C N++ YA ++ + + NND+ Sbjct: 223 GDPTKLANIFGEPDENGIYKATSCNLNDLSACNSAIGNIITYAKGEYQNSLDNAFANNDQ 282 Query: 880 ---------------VYVSMGIEDATLIPITQLNLNWKSLVTEEIRENREKLVAILNENE 746 ++ +GIE T IP + N+ ++I++ RE++V+ N+ Sbjct: 283 SKLKLLLGDRDDYFDLHSVIGIEPGTDIPEVK-NI-------DQIKQARERMVSAYLANK 334 Query: 745 YYVGKLYPFVQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERC-SY 569 YYV K + YPV L +K +L K N+ +++ +NNL+ C S Sbjct: 335 YYVDKANKIFK-TYPVTLDDSYKIALGQFMDKAQANVNLIQEKI--VKNFYNNLQNCPSV 391 Query: 568 AVQRINADIRKIGSKDL--DIFKPIEFMFSAKLSRFYKLNKQD 446 A Q + + ++DL I PI++ + L+ + ++ +D Sbjct: 392 ASQVLTSSNPNAITEDLVDKINAPIKYAYRGYLTDYGPISSED 434 >ref|WP_085180368.1| hypothetical protein [Francisella tularensis] gb|ORX29208.1| hypothetical protein ACC30_02565 [Francisella tularensis subsp. holarctica] Length = 465 Score = 63.9 bits (154), Expect = 2e-07 Identities = 55/223 (24%), Positives = 103/223 (46%), Gaps = 26/223 (11%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQDFSSQIQ----NNDK 881 GDPT+L+ IF D+N C ++ + +C N++ YA ++ + + NND+ Sbjct: 226 GDPTKLANIFGEPDENGIYKATSCNLNDLSACNSAIGNIITYAKGEYQNSLDNAFANNDQ 285 Query: 880 ---------------VYVSMGIEDATLIPITQLNLNWKSLVTEEIRENREKLVAILNENE 746 ++ +GIE T IP + N+ ++I++ RE++V+ N+ Sbjct: 286 SKLKLLLGDRDDYFDLHSVIGIEPGTDIPEVK-NI-------DQIKQARERMVSAYLANK 337 Query: 745 YYVGKLYPFVQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERC-SY 569 YYV K + YPV L +K +L K N+ +++ +NNL+ C S Sbjct: 338 YYVDKANKIFK-TYPVTLDDSYKIALGQFMDKAQANVNLIQEKI--VKNFYNNLQNCPSV 394 Query: 568 AVQRINADIRKIGSKDL--DIFKPIEFMFSAKLSRFYKLNKQD 446 A Q + + ++DL I PI++ + L+ + ++ +D Sbjct: 395 ASQVLTSSNPNAITEDLVDKINAPIKYAYRGYLTDYGPISSED 437 >ref|WP_003017460.1| hypothetical protein [Francisella tularensis] emb|CAJ80335.1| hypothetical protein FTL_1896 [Francisella tularensis subsp. holarctica LVS] gb|EBA53271.1| hypothetical protein FTHG_01751 [Francisella tularensis subsp. holarctica 257] gb|AFT93439.1| hypothetical protein FTS_1845 [Francisella tularensis subsp. holarctica FSC200] gb|AJI58915.1| hypothetical protein AW21_734 [Francisella tularensis subsp. holarctica LVS] gb|KXO28163.1| hypothetical protein IU50_04045 [Francisella tularensis] gb|KXO31604.1| hypothetical protein IU40_03975 [Francisella tularensis] gb|KXO34336.1| hypothetical protein JI73_07565 [Francisella tularensis] gb|KXO35072.1| hypothetical protein IU44_00630 [Francisella tularensis] gb|KXO39026.1| hypothetical protein IY05_03770 [Francisella tularensis] gb|KXO39070.1| hypothetical protein IY02_07850 [Francisella tularensis] gb|KXO42382.1| hypothetical protein IU41_04110 [Francisella tularensis] gb|KXO43964.1| hypothetical protein IU47_04315 [Francisella tularensis] gb|KXO46027.1| hypothetical protein IU48_03975 [Francisella tularensis] gb|KXO47652.1| hypothetical protein JI74_09460 [Francisella tularensis] gb|KXO54863.1| hypothetical protein IY04_04105 [Francisella tularensis] gb|KXO55532.1| hypothetical protein HQ99_05025 [Francisella tularensis] gb|KXO62947.1| hypothetical protein IX96_04050 [Francisella tularensis] gb|OCQ56790.1| hypothetical protein ASZ95_03635 [Francisella tularensis] gb|OCQ61083.1| hypothetical protein ASZ92_00685 [Francisella tularensis] gb|OCQ71747.1| hypothetical protein ASZ93_05815 [Francisella tularensis] gb|OLY98030.1| hypothetical protein BPP09_04435 [Francisella tularensis subsp. holarctica] gb|ORX27058.1| hypothetical protein ACC29_02570 [Francisella tularensis subsp. holarctica] gb|ORX27687.1| hypothetical protein ACC28_00705 [Francisella tularensis subsp. holarctica] gb|PLQ23224.1| hypothetical protein CYR21_03700 [Francisella tularensis subsp. holarctica] gb|PLQ29079.1| hypothetical protein CYR08_03860 [Francisella tularensis subsp. holarctica] gb|PLQ31869.1| hypothetical protein CYR11_03715 [Francisella tularensis subsp. holarctica] gb|PLQ71736.1| hypothetical protein CYR48_03735 [Francisella tularensis subsp. holarctica] gb|PLQ74375.1| hypothetical protein CYR53_03740 [Francisella tularensis subsp. holarctica] gb|PSH72011.1| hypothetical protein A4S07_003600 [Francisella tularensis] Length = 465 Score = 63.9 bits (154), Expect = 2e-07 Identities = 55/223 (24%), Positives = 103/223 (46%), Gaps = 26/223 (11%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQDFSSQIQ----NNDK 881 GDPT+L+ IF D+N C ++ + +C N++ YA ++ + + NND+ Sbjct: 226 GDPTKLANIFGEPDENGIYKATSCNLNDLSACNSAIGNIITYAKGEYQNSLDNAFANNDQ 285 Query: 880 ---------------VYVSMGIEDATLIPITQLNLNWKSLVTEEIRENREKLVAILNENE 746 ++ +GIE T IP + N+ ++I++ RE++V+ N+ Sbjct: 286 SKLKLLLGDRDDYFDLHSVIGIEPGTDIPEVK-NI-------DQIKQARERMVSAYLANK 337 Query: 745 YYVGKLYPFVQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERC-SY 569 YYV K + YPV L +K +L K N+ +++ +NNL+ C S Sbjct: 338 YYVDKANKIFK-TYPVTLDDSYKIALGQFMDKAQANVNLIQEKI--VKNFYNNLQNCPSV 394 Query: 568 AVQRINADIRKIGSKDL--DIFKPIEFMFSAKLSRFYKLNKQD 446 A Q + + ++DL I PI++ + L+ + ++ +D Sbjct: 395 ASQVLTSSNPNAITEDLVDKINAPIKYAYRGYLTDYGPISSED 437 >ref|WP_011648791.1| hypothetical protein [Francisella tularensis] gb|ABI83569.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica OSU18] gb|AJI51956.1| hypothetical protein DA46_825 [Francisella tularensis subsp. holarctica] gb|AJI65142.1| hypothetical protein CH67_168 [Francisella tularensis subsp. holarctica] gb|KXO27261.1| hypothetical protein IU45_03950 [Francisella tularensis] Length = 465 Score = 63.9 bits (154), Expect = 2e-07 Identities = 55/223 (24%), Positives = 103/223 (46%), Gaps = 26/223 (11%) Frame = -2 Query: 1036 GDPTQLSKIFNSADDN----VFECTVDSVESCLEISRNMLRYANQDFSSQIQ----NNDK 881 GDPT+L+ IF D+N C ++ + +C N++ YA ++ + + NND+ Sbjct: 226 GDPTKLANIFGEPDENGIYKATSCNLNDLSACNSAIGNIITYAKGEYQNSLDNAFANNDQ 285 Query: 880 ---------------VYVSMGIEDATLIPITQLNLNWKSLVTEEIRENREKLVAILNENE 746 ++ +GIE T IP + N+ ++I++ RE++V+ N+ Sbjct: 286 SKLKLLLGDRDDYFDLHSVIGIEPGTDIPEVK-NI-------DQIKQARERMVSAYLANK 337 Query: 745 YYVGKLYPFVQGGYPVDLHPDFKKSLNVLSKKVDKNIKVLRRNTNGAIECWNNLERC-SY 569 YYV K + YPV L +K +L K N+ +++ +NNL+ C S Sbjct: 338 YYVDKANKIFK-TYPVTLDDSYKIALGQFMDKAQANVNLIQEKI--VKNFYNNLQNCPSV 394 Query: 568 AVQRINADIRKIGSKDL--DIFKPIEFMFSAKLSRFYKLNKQD 446 A Q + + ++DL I PI++ + L+ + ++ +D Sbjct: 395 ASQVLTSSNPNAITEDLVDKINTPIKYAYRGYLTDYGPISSED 437