BLASTX nr result
ID: Ophiopogon23_contig00030304
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00030304 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPS15387.1| hypothetical protein GOBAR_AA05186 [Gossypium bar... 53 7e-06 >gb|PPS15387.1| hypothetical protein GOBAR_AA05186 [Gossypium barbadense] Length = 117 Score = 52.8 bits (125), Expect = 7e-06 Identities = 37/93 (39%), Positives = 44/93 (47%), Gaps = 12/93 (12%) Frame = +3 Query: 192 PNCVDPLLNDGEGPNPEADVETPKEVVE-------GCPKAPVDVPPNTKLPDEEPKGMEL 350 P D L G D E PK VVE P PV+VPPNT+ P EPKG L Sbjct: 20 PKDDDELPKVGVDEPKAGDEEAPKAVVEEKGEEDWAAPNTPVEVPPNTEPPVWEPKGFGL 79 Query: 351 PKGRL*A-----LFVCPKPNWEPRGVVIED*PK 434 K L A VCPK +W+ G +++D PK Sbjct: 80 LKEGLGANGLLLALVCPKTDWDANG-LLDDCPK 111