BLASTX nr result
ID: Ophiopogon23_contig00030301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00030301 (683 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009421240.1| PREDICTED: uncharacterized protein LOC104000... 57 6e-06 >ref|XP_009421240.1| PREDICTED: uncharacterized protein LOC104000826 [Musa acuminata subsp. malaccensis] Length = 258 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/40 (60%), Positives = 28/40 (70%) Frame = +3 Query: 33 RKTGRVPIRLDCPPVSLKQVKDAGLLPKCDIYLFRWINIR 152 + TG+VPIR+ C PVSLKQ G LPKC Y RWIN+R Sbjct: 219 KNTGKVPIRVGCDPVSLKQGVSGGTLPKCRFYFLRWINLR 258