BLASTX nr result
ID: Ophiopogon23_contig00030220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00030220 (882 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK80636.1| uncharacterized protein A4U43_C01F20030 [Asparagu... 58 8e-07 gb|PKI65196.1| hypothetical protein CRG98_014345, partial [Punic... 55 3e-06 ref|XP_020259842.1| succinate--CoA ligase [ADP-forming] subunit ... 58 7e-06 >gb|ONK80636.1| uncharacterized protein A4U43_C01F20030 [Asparagus officinalis] Length = 147 Score = 58.2 bits (139), Expect = 8e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 879 KHGINVPKGVAVSSVEEVRKAIKDVFPGE 793 KHGINVP+GVAVSS EEVRKAIKDVFPGE Sbjct: 36 KHGINVPRGVAVSSTEEVRKAIKDVFPGE 64 >gb|PKI65196.1| hypothetical protein CRG98_014345, partial [Punica granatum] Length = 108 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 882 GKHGINVPKGVAVSSVEEVRKAIKDVFPGE 793 GK+GINVPKGVAVSSVEE++KAI+DVFP E Sbjct: 40 GKYGINVPKGVAVSSVEEIKKAIQDVFPNE 69 >ref|XP_020259842.1| succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial [Asparagus officinalis] gb|ONK70754.1| uncharacterized protein A4U43_C04F1180 [Asparagus officinalis] Length = 422 Score = 58.2 bits (139), Expect = 7e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 879 KHGINVPKGVAVSSVEEVRKAIKDVFPGE 793 KHGINVP+GVAVSS EEVRKAIKDVFPGE Sbjct: 41 KHGINVPRGVAVSSTEEVRKAIKDVFPGE 69