BLASTX nr result
ID: Ophiopogon23_contig00030181
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00030181 (547 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259876.1| uncharacterized protein LOC109836399 [Aspara... 59 6e-07 >ref|XP_020259876.1| uncharacterized protein LOC109836399 [Asparagus officinalis] gb|ONK70791.1| uncharacterized protein A4U43_C04F1570 [Asparagus officinalis] Length = 1150 Score = 59.3 bits (142), Expect = 6e-07 Identities = 31/54 (57%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +1 Query: 373 MSGSNSNRGVTHKSFSEGTAARTRPVSLEGIMSRRKKKLNTDDK-EGASEIRKS 531 MS ++ N VT ++ +EGTAARTRP+SLE I+SRRKKKLN DDK E + + K+ Sbjct: 1 MSRTSRNSEVTCENCNEGTAARTRPISLEEILSRRKKKLNVDDKGEAIASVEKA 54