BLASTX nr result
ID: Ophiopogon23_contig00030177
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00030177 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK80561.1| uncharacterized protein A4U43_C01F19200 [Asparagu... 58 7e-07 >gb|ONK80561.1| uncharacterized protein A4U43_C01F19200 [Asparagus officinalis] Length = 499 Score = 57.8 bits (138), Expect = 7e-07 Identities = 28/59 (47%), Positives = 33/59 (55%) Frame = -1 Query: 430 YESWKKDKXXXXXXXXXXXTARGRSPNRNGKINGKSKSRSGYRSVGPDQCAFCKETGHW 254 YE K D RGRSPNR + KSK+R ++SVG +QCAFCKE GHW Sbjct: 72 YELRKNDGELFERASGDALAVRGRSPNRQRFNHSKSKNRGDHKSVGRNQCAFCKEEGHW 130