BLASTX nr result
ID: Ophiopogon23_contig00030003
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00030003 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK73036.1| uncharacterized protein A4U43_C04F26470 [Asparagu... 94 6e-19 ref|XP_020263129.1| lysine-specific histone demethylase 1 homolo... 94 7e-19 ref|XP_008779863.1| PREDICTED: lysine-specific histone demethyla... 57 4e-06 >gb|ONK73036.1| uncharacterized protein A4U43_C04F26470 [Asparagus officinalis] Length = 1059 Score = 93.6 bits (231), Expect = 6e-19 Identities = 53/74 (71%), Positives = 58/74 (78%), Gaps = 2/74 (2%) Frame = -1 Query: 272 PIGSLFKRKPRDAKKPKSLGSEIRAEQGGESPRAEAKVDSGGLGDTLASFRKRLKGPR-- 99 PIGSLFK+K R AKK K+LG EIR + E+PRAE KVDSG LGDTLASFRKRLKGPR Sbjct: 66 PIGSLFKKKARVAKKAKALGLEIRVDTEKENPRAEEKVDSGELGDTLASFRKRLKGPRKL 125 Query: 98 IDVVCDGSIDSPRE 57 DV DGS DSPR+ Sbjct: 126 KDVAGDGS-DSPRD 138 >ref|XP_020263129.1| lysine-specific histone demethylase 1 homolog 3 [Asparagus officinalis] Length = 2131 Score = 93.6 bits (231), Expect = 7e-19 Identities = 53/74 (71%), Positives = 58/74 (78%), Gaps = 2/74 (2%) Frame = -1 Query: 272 PIGSLFKRKPRDAKKPKSLGSEIRAEQGGESPRAEAKVDSGGLGDTLASFRKRLKGPR-- 99 PIGSLFK+K R AKK K+LG EIR + E+PRAE KVDSG LGDTLASFRKRLKGPR Sbjct: 66 PIGSLFKKKARVAKKAKALGLEIRVDTEKENPRAEEKVDSGELGDTLASFRKRLKGPRKL 125 Query: 98 IDVVCDGSIDSPRE 57 DV DGS DSPR+ Sbjct: 126 KDVAGDGS-DSPRD 138 >ref|XP_008779863.1| PREDICTED: lysine-specific histone demethylase 1 homolog 3-like [Phoenix dactylifera] Length = 2295 Score = 56.6 bits (135), Expect = 4e-06 Identities = 37/59 (62%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -1 Query: 272 PIGSLFK-RKPRDAKKPKSLGSEIRAEQGGESPRAEAKVDSGGLGDTLASFRKRLKGPR 99 PIGSLFK +KPR AKK K L +E RAE +PR E K DS DTLASFRK+LKGP+ Sbjct: 75 PIGSLFKLKKPRAAKKGKPLVAEDRAE----NPRDE-KGDSDEFYDTLASFRKKLKGPK 128