BLASTX nr result
ID: Ophiopogon23_contig00029780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00029780 (452 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010916641.1| PREDICTED: cyclin-dependent kinase inhibitor... 105 2e-25 ref|XP_008805250.1| PREDICTED: cyclin-dependent kinase inhibitor... 102 4e-24 gb|ONK55407.1| uncharacterized protein A4U43_UnF3650 [Asparagus ... 95 4e-22 ref|XP_010926378.1| PREDICTED: cyclin-dependent kinase inhibitor... 87 4e-18 ref|XP_008797256.1| PREDICTED: cyclin-dependent kinase inhibitor... 84 1e-16 ref|XP_008782209.1| PREDICTED: cyclin-dependent kinase inhibitor... 80 1e-15 gb|PKA49142.1| Cyclin-dependent kinase inhibitor 3 [Apostasia sh... 78 7e-15 ref|XP_010943023.1| PREDICTED: cyclin-dependent kinase inhibitor... 77 2e-14 ref|XP_010939445.1| PREDICTED: cyclin-dependent kinase inhibitor... 75 2e-13 ref|XP_020685220.1| cyclin-dependent kinase inhibitor 1-like [De... 75 2e-13 ref|XP_010943024.1| PREDICTED: cyclin-dependent kinase inhibitor... 74 4e-13 ref|XP_020586743.1| cyclin-dependent kinase inhibitor 1-like [Ph... 73 8e-13 ref|XP_008805809.1| PREDICTED: cyclin-dependent kinase inhibitor... 72 2e-12 ref|XP_009390261.1| PREDICTED: cyclin-dependent kinase inhibitor... 71 4e-12 ref|XP_018674949.1| PREDICTED: cyclin-dependent kinase inhibitor... 66 1e-10 ref|XP_018674948.1| PREDICTED: cyclin-dependent kinase inhibitor... 66 2e-10 gb|PKA59511.1| Cyclin-dependent kinase inhibitor 3 [Apostasia sh... 65 3e-09 ref|XP_020094938.1| cyclin-dependent kinase inhibitor 7-like [An... 61 1e-08 emb|CBI21439.3| unnamed protein product, partial [Vitis vinifera] 61 2e-08 ref|XP_010652818.1| PREDICTED: cyclin-dependent kinase inhibitor... 61 2e-08 >ref|XP_010916641.1| PREDICTED: cyclin-dependent kinase inhibitor 1 [Elaeis guineensis] Length = 201 Score = 105 bits (262), Expect = 2e-25 Identities = 66/125 (52%), Positives = 81/125 (64%), Gaps = 2/125 (1%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCDQEAAEL--R 198 QI+YL+LR+RSLVM P RI RS S G RC +PD G ISRC SNASC+ E R Sbjct: 43 QISYLQLRSRSLVMKP--RIMRSTVNSGGR-RCPSPDLGRISRCSSNASCEASPEERPSR 99 Query: 197 SENQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVVMQSDA 18 S + +V E ++ A S+ + R+T PSS+G DE DLESTAER S RS A +M +A Sbjct: 100 SADSEVGEVLDTAARLSNCSSGRRQTTPSSSGVDEWSDLESTAERTSRRRSRAEMMPLEA 159 Query: 17 EIEEF 3 EIEEF Sbjct: 160 EIEEF 164 >ref|XP_008805250.1| PREDICTED: cyclin-dependent kinase inhibitor 1-like [Phoenix dactylifera] Length = 201 Score = 102 bits (253), Expect = 4e-24 Identities = 63/125 (50%), Positives = 79/125 (63%), Gaps = 2/125 (1%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCDQEAAEL--R 198 QI+YL+LRNRSLVM P RI+RS +SG RC PD ISRC SNASC+ E R Sbjct: 43 QISYLRLRNRSLVMKP--RITRS-TMNSGGRRCPNPDLSRISRCSSNASCETAPEERFSR 99 Query: 197 SENQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVVMQSDA 18 S + +V E ++ A S+ ++ R T PSS+G DE DLEST E +S R A +M +A Sbjct: 100 SADPEVGEVLDTAARHSNCSSERRRTTPSSSGVDEWSDLESTVEGKSTRRPRAEMMPLEA 159 Query: 17 EIEEF 3 EIEEF Sbjct: 160 EIEEF 164 >gb|ONK55407.1| uncharacterized protein A4U43_UnF3650 [Asparagus officinalis] Length = 144 Score = 95.1 bits (235), Expect = 4e-22 Identities = 60/112 (53%), Positives = 69/112 (61%), Gaps = 2/112 (1%) Frame = -1 Query: 332 MTPPPRISRSGAKSSGS--PRCSTPDRGEISRCESNASCDQEAAELRSENQDVSEDSESV 159 MT PP RSGAKS GS PRCSTPDRGEIS CESNASC + AELR ++ V EDSE Sbjct: 1 MTVPPT-PRSGAKSPGSCSPRCSTPDRGEISLCESNASC-CDVAELRPDDPAVGEDSEGS 58 Query: 158 ACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVVMQSDAEIEEF 3 SS R + PSS +D SYDLESTAE + +A+IE+F Sbjct: 59 VYFSSLRKERGVATPSSQQKDHSYDLESTAELXXXXXXXXIT-PPEADIEDF 109 >ref|XP_010926378.1| PREDICTED: cyclin-dependent kinase inhibitor 1 [Elaeis guineensis] Length = 213 Score = 86.7 bits (213), Expect = 4e-18 Identities = 60/126 (47%), Positives = 77/126 (61%), Gaps = 3/126 (2%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCDQEAAELRSE 192 Q++YL+LR+RSLVM P RI+RS A S G RC + + G ISR SNASC+ EL S Sbjct: 56 QVSYLQLRSRSLVMKP--RIARSTANSGGR-RCPSSELGRISRRSSNASCETAPEELPSP 112 Query: 191 NQDVSEDSE---SVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVVMQSD 21 + D ED E + A S ++ +ET PSS+ +E DLE T ER S R A +M S+ Sbjct: 113 SGD-PEDGEVLDTAAPYSECSSNRKETAPSSSRVEEWTDLELTVERTSRRRRRAEMMPSE 171 Query: 20 AEIEEF 3 EIEEF Sbjct: 172 DEIEEF 177 >ref|XP_008797256.1| PREDICTED: cyclin-dependent kinase inhibitor 1-like [Phoenix dactylifera] Length = 235 Score = 83.6 bits (205), Expect = 1e-16 Identities = 58/135 (42%), Positives = 75/135 (55%), Gaps = 12/135 (8%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCDQEAAE---- 204 Q +YL+LR+RSLVMT + SG S RC +P +SRC SNAS + + E Sbjct: 64 QNSYLQLRSRSLVMTSRRTPANSG---SARARCPSPAPDRLSRCSSNASSEVASLEDRQL 120 Query: 203 -LRSENQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRS------ 45 LRS + +V ++ E++ C + RET P S R+ES DLESTA +R RS Sbjct: 121 GLRSGDPEVDDELETLPCHFERSRETRETTPLSELREESGDLESTAGKRKSRRSATEAAT 180 Query: 44 -TAVVMQSDAEIEEF 3 AVVM AEIEEF Sbjct: 181 AAAVVMPPVAEIEEF 195 >ref|XP_008782209.1| PREDICTED: cyclin-dependent kinase inhibitor 1-like [Phoenix dactylifera] Length = 213 Score = 80.5 bits (197), Expect = 1e-15 Identities = 60/126 (47%), Positives = 76/126 (60%), Gaps = 3/126 (2%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCDQEAAELRSE 192 QI+YL+LR+R LVM P RI+ S A +SGS RC + + G ISR SN SC+ E S Sbjct: 56 QISYLQLRSRRLVMKP--RITTSTA-NSGSRRCPSSEVGLISRRSSNVSCEAAPEEPPSP 112 Query: 191 NQDVSEDSE---SVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVVMQSD 21 + D EDSE + A S +D +ET SS+ +E DLE T ER S R A +M S+ Sbjct: 113 SGD-PEDSEVLDTAARYSGCSSDGKETTLSSSRVEEWSDLEPTVERTSRRRWRAEMMPSE 171 Query: 20 AEIEEF 3 AEIEEF Sbjct: 172 AEIEEF 177 >gb|PKA49142.1| Cyclin-dependent kinase inhibitor 3 [Apostasia shenzhenica] Length = 212 Score = 78.2 bits (191), Expect = 7e-15 Identities = 58/127 (45%), Positives = 72/127 (56%), Gaps = 4/127 (3%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCD-QEAAELRS 195 Q+AYL+LR+R LVMT RISRS ++S S RC + +RG ISRC S +SC+ + E R Sbjct: 56 QVAYLQLRSRKLVMTQ--RISRS-TRNSSSQRCQSAERGRISRCSSISSCETAKGDEFRC 112 Query: 194 ENQD---VSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVVMQS 24 + D ED S C D R SS ++S DLESTAER +S V S Sbjct: 113 QVPDGRKTCEDLGSSVCYLDCSRDRRGVALSSGQVNDSGDLESTAER----KSGQYVTPS 168 Query: 23 DAEIEEF 3 AEIEEF Sbjct: 169 AAEIEEF 175 >ref|XP_010943023.1| PREDICTED: cyclin-dependent kinase inhibitor 1 isoform X1 [Elaeis guineensis] Length = 215 Score = 77.0 bits (188), Expect = 2e-14 Identities = 57/129 (44%), Positives = 75/129 (58%), Gaps = 6/129 (4%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGS-PRCSTPDRGEISRCESNASCDQEAAE--- 204 Q +YL+LR+RSLVMT +I+R+ A S G+ +C +P SRC SNASC+ + E Sbjct: 56 QNSYLQLRSRSLVMTT--QIARTPATSGGARAQCPSPAS---SRCSSNASCEVVSVEDRL 110 Query: 203 --LRSENQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVVM 30 LRS + + ++ E+ C + RET PSS R ES DLESTA +R RS V Sbjct: 111 RCLRSGDLEGDDELETSPCYFGCSRESRETTPSSGMRVESCDLESTAGKRKSMRSATVA- 169 Query: 29 QSDAEIEEF 3 AEIEEF Sbjct: 170 ---AEIEEF 175 >ref|XP_010939445.1| PREDICTED: cyclin-dependent kinase inhibitor 1 [Elaeis guineensis] Length = 232 Score = 74.7 bits (182), Expect = 2e-13 Identities = 57/134 (42%), Positives = 74/134 (55%), Gaps = 11/134 (8%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGS-PRCSTPDRGEISRCESNASCDQEAAE--- 204 Q +YL+LR+RS+VMT R+ A S GS RC +P +SR SNAS + + E Sbjct: 63 QNSYLQLRSRSVVMTS----RRTPANSGGSRARCPSPAPDRLSRSSSNASSEVASVEDPR 118 Query: 203 --LRSENQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRS----- 45 S + +V ++ E++ + RET PSS R ES DLESTAE+R RS Sbjct: 119 PLQGSGDPEVDDELETLPSHFECSRERRETTPSSELRVESGDLESTAEKRKSRRSATEMA 178 Query: 44 TAVVMQSDAEIEEF 3 AVVM AEIEEF Sbjct: 179 AAVVMPPVAEIEEF 192 >ref|XP_020685220.1| cyclin-dependent kinase inhibitor 1-like [Dendrobium catenatum] gb|PKU69490.1| Cyclin-dependent kinase inhibitor 3 [Dendrobium catenatum] Length = 233 Score = 74.7 bits (182), Expect = 2e-13 Identities = 59/129 (45%), Positives = 76/129 (58%), Gaps = 6/129 (4%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCD--QEAAELR 198 ++AYL+LRNRSLVMT R+S+S A++S + R + +RG ISRC S ASC+ +E LR Sbjct: 71 EMAYLQLRNRSLVMTK--RLSKS-ARNSDAKRRGSVERGRISRCSSIASCEGVEEDDALR 127 Query: 197 ---SENQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVV-M 30 S Q D S C D E PSSN S ++ESTAER S +ST + M Sbjct: 128 YTSSGGQKPRGDLGSSVCYFECNRDRCEISPSSNQVIYSGEVESTAERESRMQSTPQLRM 187 Query: 29 QSDAEIEEF 3 S AE+EEF Sbjct: 188 PSAAELEEF 196 >ref|XP_010943024.1| PREDICTED: cyclin-dependent kinase inhibitor 1 isoform X2 [Elaeis guineensis] Length = 214 Score = 73.6 bits (179), Expect = 4e-13 Identities = 57/129 (44%), Positives = 75/129 (58%), Gaps = 6/129 (4%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGS-PRCSTPDRGEISRCESNASCDQEAAE--- 204 Q +YL+LR+RSLVMT +I+R+ A S G+ +C +P SRC SNASC+ + E Sbjct: 56 QNSYLQLRSRSLVMTT--QIARTPATSGGARAQCPSPAS---SRCSSNASCEVVSVEDRL 110 Query: 203 --LRSENQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVVM 30 LRS + + ++ E+ C + RET PSS R ES DLESTA +R RS V Sbjct: 111 RCLRSGDLEGDDELETSPCYFGCSRE-RETTPSSGMRVESCDLESTAGKRKSMRSATVA- 168 Query: 29 QSDAEIEEF 3 AEIEEF Sbjct: 169 ---AEIEEF 174 >ref|XP_020586743.1| cyclin-dependent kinase inhibitor 1-like [Phalaenopsis equestris] Length = 233 Score = 73.2 bits (178), Expect = 8e-13 Identities = 56/128 (43%), Positives = 73/128 (57%), Gaps = 5/128 (3%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCDQ-EAAELR- 198 ++AYL+LRNR LVMT R+S+S A++S R + +RG ISRC S ASCD E A LR Sbjct: 72 EMAYLQLRNRRLVMTQ--RLSKS-ARNSDVKRPGSVERGRISRCSSIASCDAVEGAHLRC 128 Query: 197 --SENQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRST-AVVMQ 27 + + D S C + E +PSSN S ++EST ER S +ST + M Sbjct: 129 TLAGGEKSRGDLGSSVCHFECDRNRNEIIPSSNQVTYSGEIESTEERESLRQSTPQLTMP 188 Query: 26 SDAEIEEF 3 AEIEEF Sbjct: 189 FAAEIEEF 196 >ref|XP_008805809.1| PREDICTED: cyclin-dependent kinase inhibitor 1-like [Phoenix dactylifera] Length = 234 Score = 72.0 bits (175), Expect = 2e-12 Identities = 52/129 (40%), Positives = 72/129 (55%), Gaps = 8/129 (6%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGE---ISRCESNASCDQEAAE- 204 Q +YL+LR+RSLVMTP RI+R+ A + G PR P +SRC SNAS + + E Sbjct: 62 QNSYLQLRSRSLVMTP--RIARTPA-NPGGPRARGPSPASSDRLSRCSSNASSEVVSVEG 118 Query: 203 ----LRSENQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAV 36 LRS +++ +D E+ C + +ET P S R ES +LESTA +R RS V Sbjct: 119 RRRCLRSGDREGDDDLETSPCYFERSRERKETTPPSELRGESCNLESTAGKRKSRRSATV 178 Query: 35 VMQSDAEIE 9 + A +E Sbjct: 179 EAAAIATVE 187 >ref|XP_009390261.1| PREDICTED: cyclin-dependent kinase inhibitor 3 [Musa acuminata subsp. malaccensis] Length = 208 Score = 70.9 bits (172), Expect = 4e-12 Identities = 53/126 (42%), Positives = 74/126 (58%), Gaps = 2/126 (1%) Frame = -1 Query: 374 YQIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCDQEAAELRS 195 +QI+ L+LR+ S+V+ P RI+RS A S G R S+P+ ISR S+ASC EAAE Sbjct: 54 HQISNLELRSCSVVLKP--RIARSAANSGGR-RNSSPELSLISRSSSDASC--EAAETPF 108 Query: 194 ENQDVSEDSESVACRSSFRADWR--ETVPSSNGRDESYDLESTAERRSPGRSTAVVMQSD 21 + ++ ++ + + FR + ET SSN + DLEST E S RSTA+ S Sbjct: 109 RSSELGQELDDA---TFFRCNGEREETAASSNDGQATSDLESTVEMGSRRRSTAIATPSV 165 Query: 20 AEIEEF 3 AE+EEF Sbjct: 166 AELEEF 171 >ref|XP_018674949.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 174 Score = 66.2 bits (160), Expect = 1e-10 Identities = 47/123 (38%), Positives = 67/123 (54%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCDQEAAELRSE 192 QI+ L+LRNRS+++ P RI+RS A +S S R S P+ G I RC S+ SC+ +E Sbjct: 47 QISNLELRNRSVILKP--RIARSTA-TSASRRRSCPELGSIFRCPSDVSCEPAVPARSAE 103 Query: 191 NQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVVMQSDAEI 12 DV+ S + E + S+N + + D ES AER S RS V S+ E+ Sbjct: 104 ELDVTTFY-------SCNVERGEMMASNNPDEGASDPESAAERESRRRSMVVATPSETEL 156 Query: 11 EEF 3 E+F Sbjct: 157 EDF 159 >ref|XP_018674948.1| PREDICTED: cyclin-dependent kinase inhibitor 5-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 196 Score = 66.2 bits (160), Expect = 2e-10 Identities = 47/123 (38%), Positives = 67/123 (54%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCDQEAAELRSE 192 QI+ L+LRNRS+++ P RI+RS A +S S R S P+ G I RC S+ SC+ +E Sbjct: 47 QISNLELRNRSVILKP--RIARSTA-TSASRRRSCPELGSIFRCPSDVSCEPAVPARSAE 103 Query: 191 NQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVVMQSDAEI 12 DV+ S + E + S+N + + D ES AER S RS V S+ E+ Sbjct: 104 ELDVTTFY-------SCNVERGEMMASNNPDEGASDPESAAERESRRRSMVVATPSETEL 156 Query: 11 EEF 3 E+F Sbjct: 157 EDF 159 >gb|PKA59511.1| Cyclin-dependent kinase inhibitor 3 [Apostasia shenzhenica] Length = 346 Score = 64.7 bits (156), Expect = 3e-09 Identities = 53/127 (41%), Positives = 70/127 (55%), Gaps = 4/127 (3%) Frame = -1 Query: 371 QIAYLKLRNRSLVMTPPPRISRSGAKSSGSPRCSTPDRGEISRCESNASCDQEAAELRSE 192 QIAYL+LR+R LVMT R RS AK+S RC + + G ISRC S +SC+ + Sbjct: 115 QIAYLELRSRKLVMTQ--RDPRS-AKNSAEQRCRSVEPGRISRCSSISSCEAVDEDDLPG 171 Query: 191 NQDVSEDSESVAC---RSSFRADWRETVPSSN-GRDESYDLESTAERRSPGRSTAVVMQS 24 + +D S C RS R + PSSN +S ++ESTAERR P + + S Sbjct: 172 GKKHCDDLASSVCDVERSGVRGAF---TPSSNIDAIDSNEMESTAERR-PLQPAPETVPS 227 Query: 23 DAEIEEF 3 AEIE+F Sbjct: 228 AAEIEDF 234 >ref|XP_020094938.1| cyclin-dependent kinase inhibitor 7-like [Ananas comosus] Length = 175 Score = 60.8 bits (146), Expect = 1e-08 Identities = 50/126 (39%), Positives = 69/126 (54%), Gaps = 4/126 (3%) Frame = -1 Query: 368 IAYLKLRNRSLVMTPPPRISRSGAKSSGSP--RCSTPDRGEISRCESNASCD--QEAAEL 201 + Y++LR+RS++M P P A+S+ +P R ++ + I RC SNASC+ E A Sbjct: 33 VTYIQLRSRSVMMKPRP------ARSAANPGARRASAELARIPRCSSNASCEAAPEDAAS 86 Query: 200 RSENQDVSEDSESVACRSSFRADWRETVPSSNGRDESYDLESTAERRSPGRSTAVVMQSD 21 RS ++ E+ SVA F D E + S DLESTA R S RSTA+ S+ Sbjct: 87 RSSGPELDEEPNSVA----FSHD--EGIRDS-------DLESTAGRESKRRSTALT-PSE 132 Query: 20 AEIEEF 3 AEIE F Sbjct: 133 AEIEHF 138 >emb|CBI21439.3| unnamed protein product, partial [Vitis vinifera] Length = 212 Score = 61.2 bits (147), Expect = 2e-08 Identities = 50/134 (37%), Positives = 71/134 (52%), Gaps = 13/134 (9%) Frame = -1 Query: 365 AYLKLRNR-SLVMTPPPRISRSGAKSSG-----SPRCSTPDRGEISR--CESNASCDQEA 210 +Y +L+NR LV++P +S + + +SG +CS+P +S C SN S E Sbjct: 44 SYEQLKNRRGLVISPENSVSEAPSGNSGRVVAEEDQCSSPSSDHVSASCCSSNGS--SEL 101 Query: 209 AELRSENQDVSEDSESV--ACRSSFRADWRETVPSSNGRDESYDLESTA---ERRSPGRS 45 + R + D+ E+S + + S R RET PSS R ES DLESTA E RS Sbjct: 102 VKERLKFADLEEESVEIETSAYSDCRESRRETTPSSELRAESDDLESTARPSEANYRHRS 161 Query: 44 TAVVMQSDAEIEEF 3 T M S++E+EEF Sbjct: 162 TVEKMPSESELEEF 175 >ref|XP_010652818.1| PREDICTED: cyclin-dependent kinase inhibitor 7 isoform X1 [Vitis vinifera] Length = 228 Score = 61.2 bits (147), Expect = 2e-08 Identities = 50/134 (37%), Positives = 71/134 (52%), Gaps = 13/134 (9%) Frame = -1 Query: 365 AYLKLRNR-SLVMTPPPRISRSGAKSSG-----SPRCSTPDRGEISR--CESNASCDQEA 210 +Y +L+NR LV++P +S + + +SG +CS+P +S C SN S E Sbjct: 60 SYEQLKNRRGLVISPENSVSEAPSGNSGRVVAEEDQCSSPSSDHVSASCCSSNGS--SEL 117 Query: 209 AELRSENQDVSEDSESV--ACRSSFRADWRETVPSSNGRDESYDLESTA---ERRSPGRS 45 + R + D+ E+S + + S R RET PSS R ES DLESTA E RS Sbjct: 118 VKERLKFADLEEESVEIETSAYSDCRESRRETTPSSELRAESDDLESTARPSEANYRHRS 177 Query: 44 TAVVMQSDAEIEEF 3 T M S++E+EEF Sbjct: 178 TVEKMPSESELEEF 191