BLASTX nr result
ID: Ophiopogon23_contig00028983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00028983 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273970.1| WD repeat-containing protein 44-like [Aspara... 66 1e-09 ref|XP_020241858.1| WD repeat-containing protein 44-like [Aspara... 61 5e-08 ref|XP_004976314.1| WD repeat-containing protein 44 isoform X2 [... 60 1e-07 ref|XP_004976313.1| WD repeat-containing protein 44 isoform X1 [... 60 1e-07 ref|XP_008802494.1| PREDICTED: WD repeat-containing protein 44-l... 59 2e-07 gb|PAN39230.1| hypothetical protein PAHAL_G01362 [Panicum hallii] 59 3e-07 ref|XP_009398403.1| PREDICTED: WD repeat-containing protein 44 [... 59 3e-07 gb|ACF81100.1| unknown [Zea mays] 58 5e-07 gb|AQK73012.1| Signal transducer [Zea mays] 58 6e-07 ref|NP_001132305.1| signal transducer [Zea mays] >gi|195651951|g... 58 7e-07 ref|XP_004953234.1| WD repeat-containing protein 44 [Setaria ita... 58 7e-07 ref|XP_008681193.1| signal transducer isoform X1 [Zea mays] 58 7e-07 ref|XP_002446829.1| WD repeat-containing protein 44 isoform X2 [... 58 7e-07 ref|XP_008678863.1| WD repeat-containing protein 44 isoform X2 [... 58 7e-07 ref|XP_021315758.1| WD repeat-containing protein 44 isoform X2 [... 58 7e-07 ref|XP_008678862.1| WD repeat-containing protein 44 isoform X1 [... 58 7e-07 ref|XP_002452509.1| WD repeat-containing protein 44 isoform X1 [... 58 7e-07 gb|AQK53878.1| Transducin/WD40 repeat-like superfamily protein [... 58 7e-07 ref|XP_021318907.1| WD repeat-containing protein 44 isoform X1 [... 58 7e-07 gb|PAN07271.1| hypothetical protein PAHAL_A02703 [Panicum hallii] 58 7e-07 >ref|XP_020273970.1| WD repeat-containing protein 44-like [Asparagus officinalis] Length = 702 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1 LQSRSAWGMVIVTAGRGGQIRTFQNFGFPF 90 LQSRSAWGMVIVTAGRGGQIRTFQNFGFPF Sbjct: 673 LQSRSAWGMVIVTAGRGGQIRTFQNFGFPF 702 >ref|XP_020241858.1| WD repeat-containing protein 44-like [Asparagus officinalis] ref|XP_020241865.1| WD repeat-containing protein 44-like [Asparagus officinalis] gb|ONK79734.1| uncharacterized protein A4U43_C01F9520 [Asparagus officinalis] Length = 696 Score = 60.8 bits (146), Expect = 5e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 LQSRSAWGMVIVTAGRGGQIRTFQNFGFPF 90 L+ RSAWGMVIVTAGRGG+IRTFQNFGFPF Sbjct: 667 LKRRSAWGMVIVTAGRGGRIRTFQNFGFPF 696 >ref|XP_004976314.1| WD repeat-containing protein 44 isoform X2 [Setaria italica] gb|KQK98201.1| hypothetical protein SETIT_009374mg [Setaria italica] Length = 783 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 SRSAWGMVIVTAGRGGQIRTFQNFGFP Sbjct: 754 SRSAWGMVIVTAGRGGQIRTFQNFGFP 780 >ref|XP_004976313.1| WD repeat-containing protein 44 isoform X1 [Setaria italica] gb|KQK98202.1| hypothetical protein SETIT_009374mg [Setaria italica] Length = 809 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 SRSAWGMVIVTAGRGGQIRTFQNFGFP Sbjct: 780 SRSAWGMVIVTAGRGGQIRTFQNFGFP 806 >ref|XP_008802494.1| PREDICTED: WD repeat-containing protein 44-like [Phoenix dactylifera] Length = 857 Score = 59.3 bits (142), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 1 LQSRSAWGMVIVTAGRGGQIRTFQNFGFP 87 + SRSAWGMVIVTAGRGG+IRTFQNFGFP Sbjct: 826 MPSRSAWGMVIVTAGRGGEIRTFQNFGFP 854 >gb|PAN39230.1| hypothetical protein PAHAL_G01362 [Panicum hallii] Length = 782 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 SRSAWGMV+VTAGRGGQIRTFQNFGFP Sbjct: 753 SRSAWGMVMVTAGRGGQIRTFQNFGFP 779 >ref|XP_009398403.1| PREDICTED: WD repeat-containing protein 44 [Musa acuminata subsp. malaccensis] Length = 870 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 LQSRSAWGMVIVTAGRGGQIRTFQNFGFPF 90 +QSRSAWGMVIVTAGRGG IR +QNFGFPF Sbjct: 839 VQSRSAWGMVIVTAGRGGAIRIYQNFGFPF 868 >gb|ACF81100.1| unknown [Zea mays] Length = 341 Score = 57.8 bits (138), Expect = 5e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 +RSAWG+VIVTAGRGGQIRTFQNFGFP Sbjct: 312 NRSAWGLVIVTAGRGGQIRTFQNFGFP 338 >gb|AQK73012.1| Signal transducer [Zea mays] Length = 686 Score = 57.8 bits (138), Expect = 6e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 +RSAWG+VIVTAGRGGQIRTFQNFGFP Sbjct: 657 NRSAWGLVIVTAGRGGQIRTFQNFGFP 683 >ref|NP_001132305.1| signal transducer [Zea mays] gb|ACG45443.1| signal transducer [Zea mays] gb|AQK73011.1| Signal transducer [Zea mays] gb|AQK73014.1| Signal transducer [Zea mays] Length = 780 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 +RSAWG+VIVTAGRGGQIRTFQNFGFP Sbjct: 751 NRSAWGLVIVTAGRGGQIRTFQNFGFP 777 >ref|XP_004953234.1| WD repeat-containing protein 44 [Setaria italica] Length = 783 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 +RSAWG+VIVTAGRGGQIRTFQNFGFP Sbjct: 754 NRSAWGLVIVTAGRGGQIRTFQNFGFP 780 >ref|XP_008681193.1| signal transducer isoform X1 [Zea mays] Length = 783 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 +RSAWG+VIVTAGRGGQIRTFQNFGFP Sbjct: 754 NRSAWGLVIVTAGRGGQIRTFQNFGFP 780 >ref|XP_002446829.1| WD repeat-containing protein 44 isoform X2 [Sorghum bicolor] gb|EES11157.1| hypothetical protein SORBI_3006G156300 [Sorghum bicolor] Length = 790 Score = 57.8 bits (138), Expect = 7e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 SRSAWG VIVTAGRGGQIRTFQNFGFP Sbjct: 761 SRSAWGTVIVTAGRGGQIRTFQNFGFP 787 >ref|XP_008678863.1| WD repeat-containing protein 44 isoform X2 [Zea mays] gb|AQK53875.1| Transducin/WD40 repeat-like superfamily protein [Zea mays] Length = 793 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 +RSAWG+VIVTAGRGGQIRTFQNFGFP Sbjct: 764 NRSAWGLVIVTAGRGGQIRTFQNFGFP 790 >ref|XP_021315758.1| WD repeat-containing protein 44 isoform X2 [Sorghum bicolor] gb|EES05484.2| hypothetical protein SORBI_3004G227500 [Sorghum bicolor] Length = 795 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 +RSAWG+VIVTAGRGGQIRTFQNFGFP Sbjct: 766 NRSAWGLVIVTAGRGGQIRTFQNFGFP 792 >ref|XP_008678862.1| WD repeat-containing protein 44 isoform X1 [Zea mays] Length = 797 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 +RSAWG+VIVTAGRGGQIRTFQNFGFP Sbjct: 768 NRSAWGLVIVTAGRGGQIRTFQNFGFP 794 >ref|XP_002452509.1| WD repeat-containing protein 44 isoform X1 [Sorghum bicolor] Length = 798 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 +RSAWG+VIVTAGRGGQIRTFQNFGFP Sbjct: 769 NRSAWGLVIVTAGRGGQIRTFQNFGFP 795 >gb|AQK53878.1| Transducin/WD40 repeat-like superfamily protein [Zea mays] Length = 809 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 +RSAWG+VIVTAGRGGQIRTFQNFGFP Sbjct: 780 NRSAWGLVIVTAGRGGQIRTFQNFGFP 806 >ref|XP_021318907.1| WD repeat-containing protein 44 isoform X1 [Sorghum bicolor] Length = 815 Score = 57.8 bits (138), Expect = 7e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 SRSAWG VIVTAGRGGQIRTFQNFGFP Sbjct: 786 SRSAWGTVIVTAGRGGQIRTFQNFGFP 812 >gb|PAN07271.1| hypothetical protein PAHAL_A02703 [Panicum hallii] Length = 854 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 7 SRSAWGMVIVTAGRGGQIRTFQNFGFP 87 +RSAWG+VIVTAGRGGQIRTFQNFGFP Sbjct: 825 NRSAWGLVIVTAGRGGQIRTFQNFGFP 851