BLASTX nr result
ID: Ophiopogon23_contig00028802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00028802 (679 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY09782.1| Zinc finger (MYND type) family protein / programm... 58 4e-06 >gb|EOY09782.1| Zinc finger (MYND type) family protein / programmed cell death 2 C-terminal domain-containing protein, putative isoform 1 [Theobroma cacao] Length = 457 Score = 57.8 bits (138), Expect = 4e-06 Identities = 30/61 (49%), Positives = 37/61 (60%) Frame = -2 Query: 678 RVFRIQLPRSNPFYSYEPPKGNGSDKPLTAGGHYQALVKKKVPTIKLEDFLPHSVDSTTR 499 +VFR QLPR+N FYS EPPKGN +DKPLT GG + V IK+E ++ S Sbjct: 150 KVFRCQLPRANTFYSNEPPKGNATDKPLTPGG------RAMVELIKMERLYATAMSSLAA 203 Query: 498 G 496 G Sbjct: 204 G 204