BLASTX nr result
ID: Ophiopogon23_contig00028727
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00028727 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245954.1| mediator-associated protein 2 [Asparagus off... 88 2e-18 >ref|XP_020245954.1| mediator-associated protein 2 [Asparagus officinalis] gb|ONK58635.1| uncharacterized protein A4U43_C09F15080 [Asparagus officinalis] Length = 219 Score = 88.2 bits (217), Expect = 2e-18 Identities = 49/97 (50%), Positives = 63/97 (64%) Frame = +3 Query: 3 FSNLNQSSQRGSERSLSHRSTVLRGTEGTSRDTFAFGHSTDMETPKPSKKKKRTDXXXXX 182 FSN +S+ RGS RS SHRSTVL+G++GT+ DTF F HST+ ETP+PS+KK+R + Sbjct: 124 FSNATRSNLRGSGRSSSHRSTVLKGSKGTA-DTFNFPHSTE-ETPQPSRKKRREEHRSGD 181 Query: 183 XXXXXXXPVSHVTDT*AARERYHGDKPMKKKNKTVDE 293 P SH+TD A +R HGD+ KK K DE Sbjct: 182 GSSRGSRPDSHLTDGSLASDRSHGDQSKKKNKKIKDE 218