BLASTX nr result
ID: Ophiopogon23_contig00028635
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00028635 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU76113.1| Autophagy protein 5 [Dendrobium catenatum] 79 5e-16 ref|XP_020674594.1| autophagy protein 5 [Dendrobium catenatum] 79 8e-15 ref|XP_008804849.1| PREDICTED: autophagy protein 5 isoform X4 [P... 76 7e-14 ref|XP_008804842.1| PREDICTED: autophagy protein 5 isoform X3 [P... 76 8e-14 ref|XP_008804833.1| PREDICTED: autophagy protein 5 isoform X2 [P... 76 8e-14 ref|XP_008804824.1| PREDICTED: autophagy protein 5 isoform X1 [P... 76 9e-14 ref|XP_020273441.1| autophagy protein 5 [Asparagus officinalis] ... 76 1e-13 ref|XP_020575144.1| autophagy protein 5-like isoform X1 [Phalaen... 74 2e-13 ref|XP_010935333.1| PREDICTED: autophagy protein 5 isoform X2 [E... 75 3e-13 ref|XP_010935332.1| PREDICTED: autophagy protein 5 isoform X1 [E... 75 3e-13 ref|XP_020092634.1| autophagy protein 5 [Ananas comosus] 75 3e-13 gb|OAY68360.1| Autophagy protein 5 [Ananas comosus] 75 3e-13 ref|XP_020594513.1| autophagy protein 5-like [Phalaenopsis eques... 74 4e-13 gb|PKA60639.1| Autophagy protein 5 [Apostasia shenzhenica] 72 2e-12 gb|OVA14282.1| Autophagy-related protein 5 [Macleaya cordata] 69 4e-11 ref|XP_018677028.1| PREDICTED: autophagy protein 5 isoform X3 [M... 68 4e-11 ref|XP_009591326.1| PREDICTED: autophagy protein 5-like isoform ... 66 5e-11 ref|XP_009386421.1| PREDICTED: autophagy protein 5 isoform X1 [M... 68 9e-11 gb|PKI45971.1| hypothetical protein CRG98_033611 [Punica granatum] 65 9e-11 ref|XP_006855600.1| autophagy protein 5 [Amborella trichopoda] >... 67 1e-10 >gb|PKU76113.1| Autophagy protein 5 [Dendrobium catenatum] Length = 155 Score = 79.0 bits (193), Expect = 5e-16 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 ME CSEEA +LVW GAIPLQIHLHESE+TTLP PPP+L+LGP Sbjct: 1 MELCSEEAVRLVWEGAIPLQIHLHESEVTTLPPPPPVLILGP 42 >ref|XP_020674594.1| autophagy protein 5 [Dendrobium catenatum] Length = 341 Score = 79.0 bits (193), Expect = 8e-15 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 ME CSEEA +LVW GAIPLQIHLHESE+TTLP PPP+L+LGP Sbjct: 1 MELCSEEAVRLVWEGAIPLQIHLHESEVTTLPPPPPVLILGP 42 >ref|XP_008804849.1| PREDICTED: autophagy protein 5 isoform X4 [Phoenix dactylifera] Length = 325 Score = 76.3 bits (186), Expect = 7e-14 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLG 6 ME CSEEA K VW GAIPLQIHLHESE+TTLP PPPILVLG Sbjct: 1 MELCSEEAVKYVWEGAIPLQIHLHESEVTTLPPPPPILVLG 41 >ref|XP_008804842.1| PREDICTED: autophagy protein 5 isoform X3 [Phoenix dactylifera] Length = 351 Score = 76.3 bits (186), Expect = 8e-14 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLG 6 ME CSEEA K VW GAIPLQIHLHESE+TTLP PPPILVLG Sbjct: 1 MELCSEEAVKYVWEGAIPLQIHLHESEVTTLPPPPPILVLG 41 >ref|XP_008804833.1| PREDICTED: autophagy protein 5 isoform X2 [Phoenix dactylifera] Length = 362 Score = 76.3 bits (186), Expect = 8e-14 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLG 6 ME CSEEA K VW GAIPLQIHLHESE+TTLP PPPILVLG Sbjct: 1 MELCSEEAVKYVWEGAIPLQIHLHESEVTTLPPPPPILVLG 41 >ref|XP_008804824.1| PREDICTED: autophagy protein 5 isoform X1 [Phoenix dactylifera] Length = 373 Score = 76.3 bits (186), Expect = 9e-14 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLG 6 ME CSEEA K VW GAIPLQIHLHESE+TTLP PPPILVLG Sbjct: 1 MELCSEEAVKYVWEGAIPLQIHLHESEVTTLPPPPPILVLG 41 >ref|XP_020273441.1| autophagy protein 5 [Asparagus officinalis] gb|ONK64231.1| uncharacterized protein A4U43_C07F23490 [Asparagus officinalis] Length = 362 Score = 75.9 bits (185), Expect = 1e-13 Identities = 37/42 (88%), Positives = 37/42 (88%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 ME SEEA KLVW GAIPLQI LHESEITTLPSPPPILVLGP Sbjct: 1 MELTSEEAIKLVWEGAIPLQIRLHESEITTLPSPPPILVLGP 42 >ref|XP_020575144.1| autophagy protein 5-like isoform X1 [Phalaenopsis equestris] Length = 272 Score = 74.3 bits (181), Expect = 2e-13 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 ME SEEA +LVW GAIPLQIHLHESE+TTLP PPP+L+LGP Sbjct: 1 MELRSEEAVRLVWEGAIPLQIHLHESEVTTLPPPPPVLILGP 42 >ref|XP_010935333.1| PREDICTED: autophagy protein 5 isoform X2 [Elaeis guineensis] Length = 329 Score = 74.7 bits (182), Expect = 3e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLG 6 ME CS+EA K VW GAIPLQIHLHESE+TTLP PPPILVLG Sbjct: 1 MELCSKEAVKYVWEGAIPLQIHLHESEVTTLPPPPPILVLG 41 >ref|XP_010935332.1| PREDICTED: autophagy protein 5 isoform X1 [Elaeis guineensis] Length = 373 Score = 74.7 bits (182), Expect = 3e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLG 6 ME CS+EA K VW GAIPLQIHLHESE+TTLP PPPILVLG Sbjct: 1 MELCSKEAVKYVWEGAIPLQIHLHESEVTTLPPPPPILVLG 41 >ref|XP_020092634.1| autophagy protein 5 [Ananas comosus] Length = 374 Score = 74.7 bits (182), Expect = 3e-13 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 ME CS+EA K VW GAIPLQIHLHESE+TTLP P PIL+LGP Sbjct: 1 MEMCSDEAVKYVWEGAIPLQIHLHESEVTTLPPPSPILILGP 42 >gb|OAY68360.1| Autophagy protein 5 [Ananas comosus] Length = 376 Score = 74.7 bits (182), Expect = 3e-13 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 ME CS+EA K VW GAIPLQIHLHESE+TTLP P PIL+LGP Sbjct: 1 MEMCSDEAVKYVWEGAIPLQIHLHESEVTTLPPPSPILILGP 42 >ref|XP_020594513.1| autophagy protein 5-like [Phalaenopsis equestris] Length = 354 Score = 74.3 bits (181), Expect = 4e-13 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 ME SEEA +LVW GAIPLQIHLHESE+TTLP PPP+L+LGP Sbjct: 1 MELRSEEAVRLVWEGAIPLQIHLHESEVTTLPPPPPVLILGP 42 >gb|PKA60639.1| Autophagy protein 5 [Apostasia shenzhenica] Length = 388 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 ME S+EA K VW GAIPLQIHLHESE+TTLP PPPIL+LGP Sbjct: 17 MELHSKEAVKYVWHGAIPLQIHLHESEVTTLPPPPPILILGP 58 >gb|OVA14282.1| Autophagy-related protein 5 [Macleaya cordata] Length = 375 Score = 68.9 bits (167), Expect = 4e-11 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = -2 Query: 128 MESCSEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 M EA K VW GAIPLQIHLHESEITTLPSPPP L+LGP Sbjct: 1 MVGLGTEAQKYVWEGAIPLQIHLHESEITTLPSPPPALILGP 42 >ref|XP_018677028.1| PREDICTED: autophagy protein 5 isoform X3 [Musa acuminata subsp. malaccensis] Length = 240 Score = 67.8 bits (164), Expect = 4e-11 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 116 SEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLG 6 SEEA K VWGGAIPLQI LHESE+TTLP PPP LVLG Sbjct: 5 SEEAAKYVWGGAIPLQIRLHESEVTTLPPPPPALVLG 41 >ref|XP_009591326.1| PREDICTED: autophagy protein 5-like isoform X1 [Nicotiana tomentosiformis] ref|XP_018623675.1| PREDICTED: autophagy protein 5-like isoform X2 [Nicotiana tomentosiformis] Length = 147 Score = 65.9 bits (159), Expect = 5e-11 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 110 EATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 EA K VW GAIPLQIHLHESE+TTLPSPPP L+L P Sbjct: 10 EAQKYVWEGAIPLQIHLHESEVTTLPSPPPALILAP 45 >ref|XP_009386421.1| PREDICTED: autophagy protein 5 isoform X1 [Musa acuminata subsp. malaccensis] Length = 366 Score = 67.8 bits (164), Expect = 9e-11 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 116 SEEATKLVWGGAIPLQIHLHESEITTLPSPPPILVLG 6 SEEA K VWGGAIPLQI LHESE+TTLP PPP LVLG Sbjct: 5 SEEAAKYVWGGAIPLQIRLHESEVTTLPPPPPALVLG 41 >gb|PKI45971.1| hypothetical protein CRG98_033611 [Punica granatum] Length = 133 Score = 64.7 bits (156), Expect = 9e-11 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 110 EATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 +A +LVW GAIPLQIHLHESE+TTLP PPP+LVL P Sbjct: 2 DAQQLVWKGAIPLQIHLHESEVTTLPPPPPLLVLAP 37 >ref|XP_006855600.1| autophagy protein 5 [Amborella trichopoda] gb|ERN17067.1| hypothetical protein AMTR_s00044p00064950 [Amborella trichopoda] Length = 343 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 110 EATKLVWGGAIPLQIHLHESEITTLPSPPPILVLGP 3 EA K VW GAIPLQIHLHESE+TTLP+PPP LVLGP Sbjct: 5 EAKKYVWEGAIPLQIHLHESEVTTLPAPPPALVLGP 40