BLASTX nr result
ID: Ophiopogon23_contig00028268
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00028268 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPR99757.1| hypothetical protein GOBAR_AA20902 [Gossypium bar... 62 1e-08 dbj|GAU20280.1| hypothetical protein TSUD_337610 [Trifolium subt... 57 7e-08 gb|KHG07590.1| creC [Gossypium arboreum] 60 7e-08 gb|KHG22746.1| creC [Gossypium arboreum] 60 7e-08 gb|KHG07589.1| creC [Gossypium arboreum] 60 7e-08 gb|KHG22747.1| creC [Gossypium arboreum] 59 2e-07 gb|ESR42042.1| hypothetical protein CICLE_v10013583mg, partial [... 58 2e-07 gb|KDO44234.1| hypothetical protein CISIN_1g0089391mg, partial [... 58 2e-07 gb|KDO44235.1| hypothetical protein CISIN_1g0089391mg, partial [... 58 2e-07 ref|XP_017187348.1| PREDICTED: WD repeat-containing protein 20-l... 58 2e-07 gb|PKI68153.1| hypothetical protein CRG98_011452 [Punica granatum] 58 2e-07 gb|KCW49742.1| hypothetical protein EUGRSUZ_K03239 [Eucalyptus g... 58 2e-07 gb|OWM69727.1| hypothetical protein CDL15_Pgr025576 [Punica gran... 58 2e-07 gb|KRH67678.1| hypothetical protein GLYMA_03G180100 [Glycine max] 58 2e-07 ref|XP_008387605.2| PREDICTED: dystrophia myotonica WD repeat-co... 58 2e-07 dbj|GAY53348.1| hypothetical protein CUMW_148610 [Citrus unshiu] 58 2e-07 ref|XP_017187347.1| PREDICTED: WD repeat-containing protein 20-l... 58 2e-07 emb|CAN60932.1| hypothetical protein VITISV_022590 [Vitis vinifera] 58 2e-07 ref|XP_020529167.1| dystrophia myotonica WD repeat-containing pr... 58 2e-07 ref|XP_006854341.2| dystrophia myotonica WD repeat-containing pr... 58 2e-07 >gb|PPR99757.1| hypothetical protein GOBAR_AA20902 [Gossypium barbadense] Length = 529 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = -2 Query: 290 SYLYSQGCAYFILLILWTFSGYF*VFDYSKVQLICGWKSYYGALLCCAW 144 +YL + G +L+L F Y VFDYSK QL+CG KSYYGALLCCAW Sbjct: 282 AYLATVGRDAVAVLVLHGFPEYLRVFDYSKEQLVCGGKSYYGALLCCAW 330 >dbj|GAU20280.1| hypothetical protein TSUD_337610 [Trifolium subterraneum] Length = 138 Score = 57.4 bits (137), Expect = 7e-08 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAWR 141 GY VFDY+K QLICG KSYYG LLCCAWR Sbjct: 76 GYLRVFDYAKEQLICGGKSYYGGLLCCAWR 105 >gb|KHG07590.1| creC [Gossypium arboreum] Length = 485 Score = 59.7 bits (143), Expect = 7e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAWR 141 GY VFDYSK QL+CG KSYYGALLCCAWR Sbjct: 291 GYLRVFDYSKEQLVCGGKSYYGALLCCAWR 320 >gb|KHG22746.1| creC [Gossypium arboreum] Length = 497 Score = 59.7 bits (143), Expect = 7e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAWR 141 GY VFDYSK QL+CG KSYYGALLCCAWR Sbjct: 288 GYLRVFDYSKEQLVCGGKSYYGALLCCAWR 317 >gb|KHG07589.1| creC [Gossypium arboreum] Length = 506 Score = 59.7 bits (143), Expect = 7e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAWR 141 GY VFDYSK QL+CG KSYYGALLCCAWR Sbjct: 312 GYLRVFDYSKEQLVCGGKSYYGALLCCAWR 341 >gb|KHG22747.1| creC [Gossypium arboreum] Length = 488 Score = 58.5 bits (140), Expect = 2e-07 Identities = 27/45 (60%), Positives = 30/45 (66%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAWR**TTEQLYYDTFSDG 96 GY VFDYSK QL+CG KSYYGALLCCAW + + SDG Sbjct: 288 GYLRVFDYSKEQLVCGGKSYYGALLCCAWSGVAFDSYWSSPNSDG 332 >gb|ESR42042.1| hypothetical protein CICLE_v10013583mg, partial [Citrus clementina] Length = 288 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 61 GYLRVFDYSKEQLICGGKSYYGALLCCAW 89 >gb|KDO44234.1| hypothetical protein CISIN_1g0089391mg, partial [Citrus sinensis] Length = 329 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 301 GYLRVFDYSKEQLICGGKSYYGALLCCAW 329 >gb|KDO44235.1| hypothetical protein CISIN_1g0089391mg, partial [Citrus sinensis] Length = 349 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 321 GYLRVFDYSKEQLICGGKSYYGALLCCAW 349 >ref|XP_017187348.1| PREDICTED: WD repeat-containing protein 20-like [Malus domestica] Length = 351 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 125 GYLRVFDYSKEQLICGGKSYYGALLCCAW 153 >gb|PKI68153.1| hypothetical protein CRG98_011452 [Punica granatum] Length = 401 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 326 GYLRVFDYSKEQLICGGKSYYGALLCCAW 354 >gb|KCW49742.1| hypothetical protein EUGRSUZ_K03239 [Eucalyptus grandis] Length = 434 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 335 GYLRVFDYSKEQLICGGKSYYGALLCCAW 363 >gb|OWM69727.1| hypothetical protein CDL15_Pgr025576 [Punica granatum] Length = 502 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 274 GYLRVFDYSKEQLICGGKSYYGALLCCAW 302 >gb|KRH67678.1| hypothetical protein GLYMA_03G180100 [Glycine max] Length = 519 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 323 GYLRVFDYSKEQLICGGKSYYGALLCCAW 351 >ref|XP_008387605.2| PREDICTED: dystrophia myotonica WD repeat-containing protein-like [Malus domestica] Length = 523 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 319 GYLRVFDYSKEQLICGGKSYYGALLCCAW 347 >dbj|GAY53348.1| hypothetical protein CUMW_148610 [Citrus unshiu] Length = 526 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 299 GYLRVFDYSKEQLICGGKSYYGALLCCAW 327 >ref|XP_017187347.1| PREDICTED: WD repeat-containing protein 20-like [Malus domestica] Length = 532 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 306 GYLRVFDYSKEQLICGGKSYYGALLCCAW 334 >emb|CAN60932.1| hypothetical protein VITISV_022590 [Vitis vinifera] Length = 536 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 289 GYLRVFDYSKEQLICGGKSYYGALLCCAW 317 >ref|XP_020529167.1| dystrophia myotonica WD repeat-containing protein isoform X2 [Amborella trichopoda] ref|XP_020529168.1| dystrophia myotonica WD repeat-containing protein isoform X2 [Amborella trichopoda] gb|ERN15808.1| hypothetical protein AMTR_s00039p00137170 [Amborella trichopoda] Length = 537 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 310 GYLRVFDYSKEQLICGGKSYYGALLCCAW 338 >ref|XP_006854341.2| dystrophia myotonica WD repeat-containing protein isoform X1 [Amborella trichopoda] ref|XP_020529163.1| dystrophia myotonica WD repeat-containing protein isoform X1 [Amborella trichopoda] ref|XP_020529165.1| dystrophia myotonica WD repeat-containing protein isoform X1 [Amborella trichopoda] ref|XP_020529166.1| dystrophia myotonica WD repeat-containing protein isoform X1 [Amborella trichopoda] Length = 540 Score = 58.2 bits (139), Expect = 2e-07 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 230 GYF*VFDYSKVQLICGWKSYYGALLCCAW 144 GY VFDYSK QLICG KSYYGALLCCAW Sbjct: 313 GYLRVFDYSKEQLICGGKSYYGALLCCAW 341