BLASTX nr result
ID: Ophiopogon23_contig00028124
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00028124 (667 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268472.1| protein RRP6-like 2 [Asparagus officinalis] ... 62 2e-07 >ref|XP_020268472.1| protein RRP6-like 2 [Asparagus officinalis] gb|ONK68872.1| uncharacterized protein A4U43_C05F16920 [Asparagus officinalis] Length = 906 Score = 61.6 bits (148), Expect = 2e-07 Identities = 33/64 (51%), Positives = 38/64 (59%) Frame = +1 Query: 1 AARKSINFTXXXXXXXXXXXXXXXXXXXEKHRASAMGRSNGEERVRGLRRQAFPPSGNRS 180 AAR++I F EK + S GRS+GEERVRGLRRQAFP SGNRS Sbjct: 843 AARRNIEFGGVEEHFKDAELDNNPSESTEKRKGSDKGRSSGEERVRGLRRQAFPASGNRS 902 Query: 181 TTYK 192 T+YK Sbjct: 903 TSYK 906