BLASTX nr result
ID: Ophiopogon23_contig00027925
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00027925 (506 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017698950.1| PREDICTED: mediator of RNA polymerase II tra... 65 3e-09 ref|XP_017698949.1| PREDICTED: mediator of RNA polymerase II tra... 65 3e-09 ref|XP_020585458.1| LOW QUALITY PROTEIN: mediator of RNA polymer... 65 4e-09 gb|ONK67984.1| uncharacterized protein A4U43_C05F5910 [Asparagus... 61 1e-08 ref|XP_010938078.1| PREDICTED: mediator of RNA polymerase II tra... 63 3e-08 ref|XP_008782719.1| PREDICTED: mediator of RNA polymerase II tra... 62 5e-08 gb|POF07329.1| mediator of rna polymerase ii transcription subun... 61 1e-07 ref|XP_020265972.1| LOW QUALITY PROTEIN: mediator of RNA polymer... 61 1e-07 gb|POE87032.1| mediator of rna polymerase ii transcription subun... 61 1e-07 ref|XP_009384953.1| PREDICTED: mediator of RNA polymerase II tra... 61 1e-07 ref|XP_023871507.1| mediator of RNA polymerase II transcription ... 61 1e-07 ref|XP_010921239.1| PREDICTED: mediator of RNA polymerase II tra... 61 1e-07 ref|XP_010921237.1| PREDICTED: mediator of RNA polymerase II tra... 61 1e-07 ref|XP_009420227.2| PREDICTED: mediator of RNA polymerase II tra... 61 1e-07 ref|XP_010278916.1| PREDICTED: mediator of RNA polymerase II tra... 60 2e-07 ref|XP_008244324.1| PREDICTED: mediator of RNA polymerase II tra... 60 2e-07 ref|XP_021685771.1| mediator of RNA polymerase II transcription ... 60 3e-07 ref|XP_021685770.1| mediator of RNA polymerase II transcription ... 60 3e-07 ref|XP_021685769.1| mediator of RNA polymerase II transcription ... 60 3e-07 ref|XP_021685768.1| mediator of RNA polymerase II transcription ... 60 3e-07 >ref|XP_017698950.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Phoenix dactylifera] Length = 762 Score = 65.5 bits (158), Expect = 3e-09 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSC VGLLV FVP WVPE+++ TLH+LA+GLRGW Sbjct: 701 AYVSCFVGLLVSFVPTWVPEVKQGTLHKLASGLRGW 736 >ref|XP_017698949.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X1 [Phoenix dactylifera] Length = 818 Score = 65.5 bits (158), Expect = 3e-09 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSC VGLLV FVP WVPE+++ TLH+LA+GLRGW Sbjct: 757 AYVSCFVGLLVSFVPTWVPEVKQGTLHKLASGLRGW 792 >ref|XP_020585458.1| LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 33A-like [Phalaenopsis equestris] Length = 451 Score = 65.1 bits (157), Expect = 4e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSC++GLLV FVPAW+PEIRK TL +LA GLRGW Sbjct: 386 AYVSCILGLLVNFVPAWIPEIRKGTLRKLAAGLRGW 421 >gb|ONK67984.1| uncharacterized protein A4U43_C05F5910 [Asparagus officinalis] Length = 146 Score = 60.8 bits (146), Expect = 1e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYV CL+GLLV FVP WVP IRKETL +LANGL+ W Sbjct: 85 AYVMCLLGLLVEFVPGWVPGIRKETLWKLANGLKSW 120 >ref|XP_010938078.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Elaeis guineensis] Length = 1330 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSC V LLV FVP WVPE+++ TLH+LA GLRGW Sbjct: 1269 AYVSCFVALLVSFVPTWVPEVKQGTLHKLAGGLRGW 1304 >ref|XP_008782719.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Phoenix dactylifera] Length = 1331 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSC VGLLV FVP WVPE+++ TL +LA+GLRGW Sbjct: 1270 AYVSCFVGLLVSFVPTWVPEVKQLTLRKLASGLRGW 1305 >gb|POF07329.1| mediator of rna polymerase ii transcription subunit 33b [Quercus suber] Length = 369 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AY+SCLVGL+V F P+W+ E++ ETL +LANGLRGW Sbjct: 305 AYLSCLVGLMVSFTPSWIQEVKLETLRKLANGLRGW 340 >ref|XP_020265972.1| LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 33A-like [Asparagus officinalis] Length = 1070 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYV CL+GLLV FVP WVP IRKETL +LANGL+ W Sbjct: 1009 AYVMCLLGLLVEFVPGWVPGIRKETLWKLANGLKSW 1044 >gb|POE87032.1| mediator of rna polymerase ii transcription subunit 33a [Quercus suber] Length = 1291 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AY+SCLVGL+V F P+W+ E++ ETL +LANGLRGW Sbjct: 1227 AYLSCLVGLMVSFTPSWIQEVKLETLRKLANGLRGW 1262 >ref|XP_009384953.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Musa acuminata subsp. malaccensis] Length = 1330 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSC VGLLV F PAWV E+++ETL +LA+GLRGW Sbjct: 1269 AYVSCFVGLLVKFAPAWVHEVKQETLRKLASGLRGW 1304 >ref|XP_023871507.1| mediator of RNA polymerase II transcription subunit 33A-like [Quercus suber] Length = 1331 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AY+SCLVGL+V F P+W+ E++ ETL +LANGLRGW Sbjct: 1267 AYLSCLVGLMVSFTPSWIQEVKLETLRKLANGLRGW 1302 >ref|XP_010921239.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Elaeis guineensis] Length = 1331 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSC VGLLV FVP WVPE+++ TL +LA+GLRGW Sbjct: 1270 AYVSCFVGLLVSFVPTWVPEVKQLTLCKLASGLRGW 1305 >ref|XP_010921237.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X1 [Elaeis guineensis] Length = 1352 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSC VGLLV FVP WVPE+++ TL +LA+GLRGW Sbjct: 1291 AYVSCFVGLLVSFVPTWVPEVKQLTLCKLASGLRGW 1326 >ref|XP_009420227.2| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 1362 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSC VGLLV F PAWV E ++E LH+LA+GLRGW Sbjct: 1301 AYVSCFVGLLVNFAPAWVLEAKQEALHKLASGLRGW 1336 >ref|XP_010278916.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Nelumbo nucifera] Length = 1322 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSC VGL+V F PAW+ E+R+E L +LANGLRGW Sbjct: 1258 AYVSCFVGLVVHFAPAWIQEVRQEILRKLANGLRGW 1293 >ref|XP_008244324.1| PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Prunus mume] Length = 1323 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSCLVGL+V F PAW+ E++ ETL +LA GLRGW Sbjct: 1257 AYVSCLVGLMVNFAPAWIQEVKVETLKKLAGGLRGW 1292 >ref|XP_021685771.1| mediator of RNA polymerase II transcription subunit 33A-like isoform X4 [Hevea brasiliensis] ref|XP_021685772.1| mediator of RNA polymerase II transcription subunit 33A-like isoform X4 [Hevea brasiliensis] Length = 1151 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSCLV LLV F PAW+ E+R ETL +LA+GLRGW Sbjct: 1087 AYVSCLVHLLVSFTPAWIQEVRLETLKKLASGLRGW 1122 >ref|XP_021685770.1| mediator of RNA polymerase II transcription subunit 33A-like isoform X3 [Hevea brasiliensis] Length = 1196 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSCLV LLV F PAW+ E+R ETL +LA+GLRGW Sbjct: 1132 AYVSCLVHLLVSFTPAWIQEVRLETLKKLASGLRGW 1167 >ref|XP_021685769.1| mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Hevea brasiliensis] Length = 1328 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSCLV LLV F PAW+ E+R ETL +LA+GLRGW Sbjct: 1264 AYVSCLVHLLVSFTPAWIQEVRLETLKKLASGLRGW 1299 >ref|XP_021685768.1| mediator of RNA polymerase II transcription subunit 33A-like isoform X1 [Hevea brasiliensis] Length = 1330 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 2 AYVSCLVGLLVGFVPAWVPEIRKETLHRLANGLRGW 109 AYVSCLV LLV F PAW+ E+R ETL +LA+GLRGW Sbjct: 1266 AYVSCLVHLLVSFTPAWIQEVRLETLKKLASGLRGW 1301