BLASTX nr result
ID: Ophiopogon23_contig00027773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00027773 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256630.1| protein PHLOEM PROTEIN 2-LIKE A1-like [Aspar... 90 4e-19 >ref|XP_020256630.1| protein PHLOEM PROTEIN 2-LIKE A1-like [Asparagus officinalis] gb|ONK74822.1| uncharacterized protein A4U43_C03F10490 [Asparagus officinalis] Length = 271 Score = 90.1 bits (222), Expect = 4e-19 Identities = 54/103 (52%), Positives = 63/103 (61%) Frame = +3 Query: 99 GMGAGSSVPTQEVAKKPTAVSVPAASKTLQEESKGSNYRSTTEAPGTKEEPSKYVEVPME 278 G A + ++E KKPT S P SKT EE GSN R+ E KE+PSK VE E Sbjct: 9 GTSAQVAEVSKEDTKKPTTESAPDVSKTY-EELVGSNSRTIAEVSKAKEKPSKPVEEWKE 67 Query: 279 PPAKPKNVPHRYLAIVKGAESADNPSVGSLLDKIRSSGIFLNN 407 P PK +PH Y AI+K AD+PS G LLDKI+SSGIFLNN Sbjct: 68 PATIPKKIPHMYQAIIK---QADDPSDGGLLDKIQSSGIFLNN 107