BLASTX nr result
ID: Ophiopogon23_contig00027549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00027549 (505 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009391482.1| PREDICTED: uncharacterized protein LOC103977... 75 1e-13 ref|XP_008801097.1| PREDICTED: uncharacterized protein LOC103715... 72 1e-12 gb|KMZ66335.1| hypothetical protein ZOSMA_2G03520 [Zostera marina] 72 3e-12 gb|PKA58428.1| hypothetical protein AXF42_Ash013934 [Apostasia s... 71 4e-12 ref|XP_020275738.1| uncharacterized protein LOC109850199 [Aspara... 71 4e-12 ref|XP_010921693.1| PREDICTED: nucleolar protein 16 [Elaeis guin... 70 1e-11 gb|OAY83589.1| hypothetical protein ACMD2_04757 [Ananas comosus] 69 4e-11 ref|XP_020086659.1| uncharacterized protein LOC109709027 [Ananas... 67 1e-10 ref|XP_002523066.1| PREDICTED: nucleolar protein 16 [Ricinus com... 66 4e-10 ref|XP_020696241.1| uncharacterized protein LOC110109492 [Dendro... 65 5e-10 ref|XP_022770921.1| uncharacterized protein LOC111314132 [Durio ... 65 7e-10 ref|XP_022863274.1| uncharacterized protein LOC111383396 [Olea e... 65 1e-09 gb|PPD83250.1| hypothetical protein GOBAR_DD19818 [Gossypium bar... 65 1e-09 ref|XP_017614204.1| PREDICTED: uncharacterized protein LOC108459... 65 1e-09 ref|XP_016715227.1| PREDICTED: uncharacterized protein LOC107928... 64 1e-09 ref|XP_012474054.1| PREDICTED: uncharacterized protein LOC105790... 64 1e-09 gb|OMO81914.1| Ribosome biogenesis protein Nop16 [Corchorus olit... 64 2e-09 gb|KJB23276.1| hypothetical protein B456_004G089300 [Gossypium r... 64 2e-09 gb|OMO63827.1| Ribosome biogenesis protein Nop16 [Corchorus caps... 64 3e-09 ref|XP_010259588.1| PREDICTED: uncharacterized protein LOC104598... 62 5e-09 >ref|XP_009391482.1| PREDICTED: uncharacterized protein LOC103977635 [Musa acuminata subsp. malaccensis] Length = 190 Score = 75.1 bits (183), Expect = 1e-13 Identities = 38/59 (64%), Positives = 47/59 (79%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLEN 39 SV+RNY+ F +VSNPN+LS+ TPQIVQ +LQVP D + P+SEFDPIDSGSDLE+ Sbjct: 57 SVIRNYQAFGVVSNPNILSVRARTPQIVQLSTLQVP--DPEFTPVSEFDPIDSGSDLES 113 >ref|XP_008801097.1| PREDICTED: uncharacterized protein LOC103715292 [Phoenix dactylifera] Length = 187 Score = 72.4 bits (176), Expect = 1e-12 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLEN 39 +V+RNY+ F +V+NPNLL + TP IVQ SLQ+P D + P+SEFDPIDSGSDLE+ Sbjct: 54 TVIRNYRSFGVVANPNLLGVRARTPHIVQSSSLQIP--DREAPPVSEFDPIDSGSDLES 110 >gb|KMZ66335.1| hypothetical protein ZOSMA_2G03520 [Zostera marina] Length = 206 Score = 71.6 bits (174), Expect = 3e-12 Identities = 39/60 (65%), Positives = 44/60 (73%), Gaps = 1/60 (1%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIH-DEDQKPLSEFDPIDSGSDLEN 39 SV+ NYK F +VSNPNLL + TP IVQ PSLQVP E K ++EFDPIDSGSDLEN Sbjct: 51 SVIDNYKAFGVVSNPNLLGVRARTPHIVQDPSLQVPATIFEPPKLVNEFDPIDSGSDLEN 110 >gb|PKA58428.1| hypothetical protein AXF42_Ash013934 [Apostasia shenzhenica] Length = 195 Score = 71.2 bits (173), Expect = 4e-12 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLEN 39 SV+RNY+ F +V+NPNLLS+ P IVQ LQ+P H D P+SEFDPIDSGSDLE+ Sbjct: 60 SVIRNYRTFGVVANPNLLSVRARIPAIVQSEDLQLPKH--DAPPVSEFDPIDSGSDLES 116 >ref|XP_020275738.1| uncharacterized protein LOC109850199 [Asparagus officinalis] ref|XP_020275739.1| uncharacterized protein LOC109850199 [Asparagus officinalis] ref|XP_020275740.1| uncharacterized protein LOC109850199 [Asparagus officinalis] gb|ONK62945.1| uncharacterized protein A4U43_C07F9750 [Asparagus officinalis] Length = 182 Score = 70.9 bits (172), Expect = 4e-12 Identities = 37/59 (62%), Positives = 42/59 (71%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLEN 39 SV+RNY+ F +VSNPNLL + TPQIVQC SLQVP HDED IDSGSDLE+ Sbjct: 52 SVIRNYRSFGVVSNPNLLGVRARTPQIVQCSSLQVPNHDED------LGSIDSGSDLES 104 >ref|XP_010921693.1| PREDICTED: nucleolar protein 16 [Elaeis guineensis] Length = 188 Score = 69.7 bits (169), Expect = 1e-11 Identities = 35/59 (59%), Positives = 44/59 (74%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLEN 39 SV+RNY+ F +V+NPN+L + T IVQ SLQVP D + P+SEFDPIDSGSDLE+ Sbjct: 55 SVIRNYRSFGVVANPNVLGVRARTAHIVQSSSLQVP--DREAPPVSEFDPIDSGSDLES 111 >gb|OAY83589.1| hypothetical protein ACMD2_04757 [Ananas comosus] Length = 194 Score = 68.6 bits (166), Expect = 4e-11 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 2/64 (3%) Frame = -3 Query: 224 ATRSVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIH--DEDQKPLSEFDPIDSGS 51 A SV+ NY+ F +V+NPNLL + TP IVQ LQVP D+ P SEFDPID+GS Sbjct: 54 AKGSVISNYRSFGVVANPNLLGVHARTPHIVQSSPLQVPQRRADDPPAPASEFDPIDTGS 113 Query: 50 DLEN 39 DLEN Sbjct: 114 DLEN 117 >ref|XP_020086659.1| uncharacterized protein LOC109709027 [Ananas comosus] Length = 194 Score = 67.4 bits (163), Expect = 1e-10 Identities = 36/64 (56%), Positives = 42/64 (65%), Gaps = 2/64 (3%) Frame = -3 Query: 224 ATRSVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKP--LSEFDPIDSGS 51 A SV+ NY+ F +V+NPNLL + TP IVQ LQVP D P SEFDPID+GS Sbjct: 54 AKGSVISNYRSFGVVANPNLLGVRARTPHIVQSSPLQVPQRRADDPPARASEFDPIDTGS 113 Query: 50 DLEN 39 DLEN Sbjct: 114 DLEN 117 >ref|XP_002523066.1| PREDICTED: nucleolar protein 16 [Ricinus communis] gb|EEF39251.1| conserved hypothetical protein [Ricinus communis] Length = 190 Score = 65.9 bits (159), Expect = 4e-10 Identities = 33/58 (56%), Positives = 40/58 (68%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLE 42 SV++NYK F +VSNPNLL + T IVQ SLQVP + P+ EF+P DSGSDLE Sbjct: 53 SVIQNYKSFGVVSNPNLLGVRSRTSHIVQTESLQVPPSPPPEGPIDEFEPTDSGSDLE 110 >ref|XP_020696241.1| uncharacterized protein LOC110109492 [Dendrobium catenatum] gb|PKU63731.1| hypothetical protein MA16_Dca014291 [Dendrobium catenatum] Length = 194 Score = 65.5 bits (158), Expect = 5e-10 Identities = 32/59 (54%), Positives = 42/59 (71%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLEN 39 S +RNY+ F +V+NPNLL + T IVQ LQ+P D D P+SEFDP+D+GSDLE+ Sbjct: 61 SYLRNYRTFGVVANPNLLGVRARTTDIVQSAELQLP--DRDAAPVSEFDPVDNGSDLES 117 >ref|XP_022770921.1| uncharacterized protein LOC111314132 [Durio zibethinus] Length = 193 Score = 65.1 bits (157), Expect = 7e-10 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLE 42 SV++NYK F +VSNPN L + T IV+ SLQVP +P EF+PIDSGSDLE Sbjct: 55 SVIQNYKSFGVVSNPNFLGVRYRTSHIVESDSLQVPQPPPSDRPADEFEPIDSGSDLE 112 >ref|XP_022863274.1| uncharacterized protein LOC111383396 [Olea europaea var. sylvestris] Length = 188 Score = 64.7 bits (156), Expect = 1e-09 Identities = 32/58 (55%), Positives = 41/58 (70%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLE 42 SV+ NYK F +VSNPN L + TP +V+ +LQVP +D P+ EF+PIDSGSDLE Sbjct: 52 SVIENYKSFGVVSNPNFLGVRSRTPHMVESDALQVPA--QDATPVDEFEPIDSGSDLE 107 >gb|PPD83250.1| hypothetical protein GOBAR_DD19818 [Gossypium barbadense] Length = 193 Score = 64.7 bits (156), Expect = 1e-09 Identities = 33/58 (56%), Positives = 39/58 (67%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLE 42 SV++NYK F IVSNPN L + T IV+ SLQVP +P EF+PIDSGSDLE Sbjct: 55 SVIQNYKSFGIVSNPNYLGVRSRTSHIVESDSLQVPHSPPSDEPADEFEPIDSGSDLE 112 >ref|XP_017614204.1| PREDICTED: uncharacterized protein LOC108459355 [Gossypium arboreum] gb|KHG01199.1| Nucleolar 16 [Gossypium arboreum] gb|PPS17144.1| hypothetical protein GOBAR_AA03441 [Gossypium barbadense] Length = 193 Score = 64.7 bits (156), Expect = 1e-09 Identities = 33/58 (56%), Positives = 39/58 (67%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLE 42 SV++NYK F IVSNPN L + T IV+ SLQVP +P EF+PIDSGSDLE Sbjct: 55 SVIQNYKSFGIVSNPNYLGVRSRTSHIVESDSLQVPHSPPSDEPADEFEPIDSGSDLE 112 >ref|XP_016715227.1| PREDICTED: uncharacterized protein LOC107928465 [Gossypium hirsutum] Length = 193 Score = 64.3 bits (155), Expect = 1e-09 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLE 42 SV++NYK F +VSNPN L + T IV+ SLQVP +P EF+PIDSGSDLE Sbjct: 55 SVIQNYKSFGVVSNPNYLGVRSRTSHIVESDSLQVPHSPPSDEPADEFEPIDSGSDLE 112 >ref|XP_012474054.1| PREDICTED: uncharacterized protein LOC105790819 [Gossypium raimondii] ref|XP_016697694.1| PREDICTED: uncharacterized protein LOC107913568 [Gossypium hirsutum] gb|KJB23275.1| hypothetical protein B456_004G089300 [Gossypium raimondii] Length = 193 Score = 64.3 bits (155), Expect = 1e-09 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLE 42 SV++NYK F +VSNPN L + T IV+ SLQVP +P EF+PIDSGSDLE Sbjct: 55 SVIQNYKSFGVVSNPNYLGVRSRTSHIVESDSLQVPHSPPSDEPADEFEPIDSGSDLE 112 >gb|OMO81914.1| Ribosome biogenesis protein Nop16 [Corchorus olitorius] Length = 215 Score = 64.3 bits (155), Expect = 2e-09 Identities = 33/58 (56%), Positives = 38/58 (65%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLE 42 SV+ NYK F VSNPNLL + T IV+ SLQVP +P EF+PIDSGSDLE Sbjct: 55 SVIHNYKSFGFVSNPNLLGVRSRTSHIVESDSLQVPNPPPSDEPADEFEPIDSGSDLE 112 >gb|KJB23276.1| hypothetical protein B456_004G089300 [Gossypium raimondii] Length = 226 Score = 64.3 bits (155), Expect = 2e-09 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLE 42 SV++NYK F +VSNPN L + T IV+ SLQVP +P EF+PIDSGSDLE Sbjct: 55 SVIQNYKSFGVVSNPNYLGVRSRTSHIVESDSLQVPHSPPSDEPADEFEPIDSGSDLE 112 >gb|OMO63827.1| Ribosome biogenesis protein Nop16 [Corchorus capsularis] Length = 193 Score = 63.5 bits (153), Expect = 3e-09 Identities = 33/58 (56%), Positives = 38/58 (65%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLE 42 SV+ NYK F VSNPNLL + T IV+ SLQVP +P EF+PIDSGSDLE Sbjct: 55 SVIHNYKSFGFVSNPNLLGVRSRTSHIVESDSLQVPNPPPSDEPAYEFEPIDSGSDLE 112 >ref|XP_010259588.1| PREDICTED: uncharacterized protein LOC104598964 isoform X2 [Nelumbo nucifera] Length = 173 Score = 62.4 bits (150), Expect = 5e-09 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = -3 Query: 215 SVVRNYK*FVIVSNPNLLSIGVLTPQIVQCPSLQVPIHDEDQKPLSEFDPIDSGSDLE 42 +V+ NYK +VSNPNLLS+ TP I++ SLQVP D SE +PIDSGSDLE Sbjct: 51 TVINNYKSLGVVSNPNLLSVRSRTPHIIESDSLQVPPPDATINSTSECEPIDSGSDLE 108