BLASTX nr result
ID: Ophiopogon23_contig00027544
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00027544 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024185802.1| uncharacterized protein LOC112190588 [Rosa c... 62 2e-08 >ref|XP_024185802.1| uncharacterized protein LOC112190588 [Rosa chinensis] ref|XP_024185803.1| uncharacterized protein LOC112190588 [Rosa chinensis] gb|PRQ47017.1| putative transposase, Tnp1/En/Spm [Rosa chinensis] Length = 421 Score = 61.6 bits (148), Expect = 2e-08 Identities = 34/81 (41%), Positives = 46/81 (56%) Frame = +3 Query: 33 IHGSLVGQDNIKALVMTPILPDTPLIFPLDGPEIYTVGQAVGTFVEWPKRLVISGRTPMP 212 IHG +G+DN+ V+ I+ D L FP+ +I TVG A+GT V WP++LV+ TP P Sbjct: 266 IHGVPLGEDNVHVSVVGTIVHDALLPFPMKDADIVTVGDAIGTCVAWPRKLVV---TPAP 322 Query: 213 AKGKKVAPQVPTKGSLPTKGS 275 K Q TK + P K S Sbjct: 323 EAPPKPIEQKKTKRANPKKRS 343