BLASTX nr result
ID: Ophiopogon23_contig00027139
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00027139 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246696.1| box C/D snoRNA protein 1-like [Asparagus off... 66 1e-09 ref|XP_008781476.1| PREDICTED: putative box C/D snoRNA protein S... 65 3e-09 gb|OAY80140.1| Box C/D snoRNA protein 1 [Ananas comosus] 64 4e-09 ref|XP_020110311.1| putative box C/D snoRNA protein SPCC613.07 [... 64 4e-09 ref|XP_010930894.1| PREDICTED: putative box C/D snoRNA protein S... 60 9e-08 ref|XP_020583758.1| uncharacterized protein LOC110026897 isoform... 57 2e-06 ref|XP_020583756.1| putative box C/D snoRNA protein SPCC613.07 i... 57 2e-06 ref|XP_020693425.1| uncharacterized protein LOC110107492 [Dendro... 55 5e-06 gb|PKU70552.1| hypothetical protein MA16_Dca008669 [Dendrobium c... 55 5e-06 gb|PKU60436.1| hypothetical protein MA16_Dca027104 [Dendrobium c... 55 5e-06 >ref|XP_020246696.1| box C/D snoRNA protein 1-like [Asparagus officinalis] gb|ONK58125.1| uncharacterized protein A4U43_C09F8470 [Asparagus officinalis] Length = 439 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 444 DFQQELRDAYSDLIGEINPDDFLCLDDGYDEAD 346 DFQQELRDAYSDLIGEINPDDFLCLDDG++ D Sbjct: 389 DFQQELRDAYSDLIGEINPDDFLCLDDGFNGMD 421 >ref|XP_008781476.1| PREDICTED: putative box C/D snoRNA protein SPCC613.07 [Phoenix dactylifera] Length = 440 Score = 64.7 bits (156), Expect = 3e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 444 DFQQELRDAYSDLIGEINPDDFLCLDDGYDEAD 346 DFQQE++DAYSDLIGEINPDDFLCLD GY E D Sbjct: 377 DFQQEMKDAYSDLIGEINPDDFLCLDGGYGEED 409 >gb|OAY80140.1| Box C/D snoRNA protein 1 [Ananas comosus] Length = 440 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 444 DFQQELRDAYSDLIGEINPDDFLCLDDGYDEAD 346 DF+QE+RDAYSDL+GE+NPDDFLCLDDGY E + Sbjct: 379 DFEQEMRDAYSDLLGEMNPDDFLCLDDGYSEEE 411 >ref|XP_020110311.1| putative box C/D snoRNA protein SPCC613.07 [Ananas comosus] Length = 443 Score = 64.3 bits (155), Expect = 4e-09 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 444 DFQQELRDAYSDLIGEINPDDFLCLDDGYDEAD 346 DF+QE+RDAYSDL+GE+NPDDFLCLDDGY E + Sbjct: 382 DFEQEMRDAYSDLLGEMNPDDFLCLDDGYSEEE 414 >ref|XP_010930894.1| PREDICTED: putative box C/D snoRNA protein SPCC613.07 [Elaeis guineensis] Length = 314 Score = 60.1 bits (144), Expect = 9e-08 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 444 DFQQELRDAYSDLIGEINPDDFLCLDDGYDEAD 346 DFQQE++DAYSD IGEINPDDFLCLD G E D Sbjct: 252 DFQQEVKDAYSDFIGEINPDDFLCLDSGCSEED 284 >ref|XP_020583758.1| uncharacterized protein LOC110026897 isoform X2 [Phalaenopsis equestris] Length = 386 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 441 FQQELRDAYSDLIGEINPDDFLCLDDGYDEA 349 FQQELRDAYS+LIGE+NPDDFLCLD Y +A Sbjct: 285 FQQELRDAYSELIGEMNPDDFLCLDGVYGDA 315 >ref|XP_020583756.1| putative box C/D snoRNA protein SPCC613.07 isoform X1 [Phalaenopsis equestris] Length = 476 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 441 FQQELRDAYSDLIGEINPDDFLCLDDGYDEA 349 FQQELRDAYS+LIGE+NPDDFLCLD Y +A Sbjct: 375 FQQELRDAYSELIGEMNPDDFLCLDGVYGDA 405 >ref|XP_020693425.1| uncharacterized protein LOC110107492 [Dendrobium catenatum] Length = 481 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -3 Query: 441 FQQELRDAYSDLIGEINPDDFLCLDDGYDEA 349 F++ELRDAYSDLIGE+NPDDFLCLD Y+++ Sbjct: 362 FEKELRDAYSDLIGEMNPDDFLCLDGVYEDS 392 >gb|PKU70552.1| hypothetical protein MA16_Dca008669 [Dendrobium catenatum] Length = 528 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -3 Query: 441 FQQELRDAYSDLIGEINPDDFLCLDDGYDEA 349 F++ELRDAYSDLIGE+NPDDFLCLD Y+++ Sbjct: 409 FEKELRDAYSDLIGEMNPDDFLCLDGVYEDS 439 >gb|PKU60436.1| hypothetical protein MA16_Dca027104 [Dendrobium catenatum] Length = 528 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -3 Query: 441 FQQELRDAYSDLIGEINPDDFLCLDDGYDEA 349 F++ELRDAYSDLIGE+NPDDFLCLD Y+++ Sbjct: 344 FEKELRDAYSDLIGEMNPDDFLCLDGVYEDS 374