BLASTX nr result
ID: Ophiopogon23_contig00025448
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00025448 (605 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247030.1| uncharacterized protein LOC109824768 [Aspara... 59 4e-10 >ref|XP_020247030.1| uncharacterized protein LOC109824768 [Asparagus officinalis] gb|ONK82073.1| uncharacterized protein A4U43_C01F35840 [Asparagus officinalis] Length = 313 Score = 58.5 bits (140), Expect(2) = 4e-10 Identities = 31/55 (56%), Positives = 39/55 (70%) Frame = +2 Query: 440 TLLLKTKLQFPHLCHDSINQDPKLPTKKEGKLPPTRIGDGGAQGNDWSTSILLFG 604 TL+LK K + +CHDS+N+DP +E + P R GDGG +GNDWSTSILLFG Sbjct: 43 TLVLKAKFRSFLVCHDSMNKDP---AGEESRAPLERNGDGG-KGNDWSTSILLFG 93 Score = 33.5 bits (75), Expect(2) = 4e-10 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 316 VILPSKS*PISCTFYSPPKTLALTPKNPTQS--QPQTSKLP 432 ++L SKS PISC F S P+TL LT + Q P+T P Sbjct: 1 MLLSSKSYPISCNFPSHPRTLTLTLTSANQRTFAPKTLNFP 41