BLASTX nr result
ID: Ophiopogon23_contig00025151
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00025151 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020249204.1| single-stranded DNA-bindig protein WHY2, mit... 100 5e-23 gb|ONK56487.1| uncharacterized protein A4U43_C10F9260 [Asparagus... 100 6e-23 ref|XP_008803798.1| PREDICTED: single-stranded DNA-bindig protei... 79 3e-15 ref|XP_010927809.1| PREDICTED: single-stranded DNA-bindig protei... 78 5e-15 gb|OVA05795.1| Plant transcription factor [Macleaya cordata] 77 1e-14 ref|XP_010912668.1| PREDICTED: single-stranded DNA-bindig protei... 77 1e-14 ref|XP_020107565.1| single-stranded DNA-bindig protein WHY2, mit... 76 3e-14 gb|PIA47076.1| hypothetical protein AQUCO_01400047v1 [Aquilegia ... 74 2e-13 ref|XP_008795280.1| PREDICTED: single-stranded DNA-bindig protei... 74 3e-13 ref|XP_008795279.1| PREDICTED: single-stranded DNA-bindig protei... 74 3e-13 ref|XP_017699270.1| PREDICTED: single-stranded DNA-bindig protei... 74 3e-13 ref|XP_017699269.1| PREDICTED: single-stranded DNA-bindig protei... 74 3e-13 gb|AIA25913.1| plant transcriptional regulator PBF-2, partial [F... 67 3e-12 ref|XP_003574931.1| PREDICTED: single-stranded DNA-binding prote... 67 5e-11 gb|KQL28659.1| hypothetical protein SETIT_018290mg [Setaria ital... 67 6e-11 ref|XP_004951836.1| single-stranded DNA-binding protein WHY2, mi... 67 7e-11 ref|XP_002453336.1| single-stranded DNA-binding protein WHY2, mi... 67 7e-11 ref|XP_006646903.1| PREDICTED: single-stranded DNA-binding prote... 67 1e-10 ref|XP_020589124.1| single-stranded DNA-binding protein WHY2, mi... 67 1e-10 gb|OEL22532.1| Single-stranded DNA-bindig protein WHY2, mitochon... 66 1e-10 >ref|XP_020249204.1| single-stranded DNA-bindig protein WHY2, mitochondrial-like [Asparagus officinalis] Length = 327 Score = 100 bits (250), Expect = 5e-23 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 2/59 (3%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQL--SSAPGQMKEPEMRLSPDFEWGR 171 FSVPVTKAEFAVMRTAFGFALPHIMGWDR+VTPQ +S Q+KEP MRL+PDFEWGR Sbjct: 269 FSVPVTKAEFAVMRTAFGFALPHIMGWDRVVTPQFVNTSNSAQLKEPTMRLTPDFEWGR 327 >gb|ONK56487.1| uncharacterized protein A4U43_C10F9260 [Asparagus officinalis] Length = 345 Score = 100 bits (250), Expect = 6e-23 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 2/59 (3%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQL--SSAPGQMKEPEMRLSPDFEWGR 171 FSVPVTKAEFAVMRTAFGFALPHIMGWDR+VTPQ +S Q+KEP MRL+PDFEWGR Sbjct: 287 FSVPVTKAEFAVMRTAFGFALPHIMGWDRVVTPQFVNTSNSAQLKEPTMRLTPDFEWGR 345 >ref|XP_008803798.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial-like isoform X2 [Phoenix dactylifera] Length = 241 Score = 79.0 bits (193), Expect = 3e-15 Identities = 38/58 (65%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQM-KEPEMRLSPDFEWGR 171 FSVPV KAEFAV+R AF F LP+IMGWD++V PQL S G+ K+ EMR PDFEW R Sbjct: 184 FSVPVAKAEFAVVRAAFSFILPYIMGWDQVVKPQLESVEGERPKQREMRPDPDFEWER 241 >ref|XP_010927809.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial [Elaeis guineensis] Length = 241 Score = 78.2 bits (191), Expect = 5e-15 Identities = 37/58 (63%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSS-APGQMKEPEMRLSPDFEWGR 171 FSVPVTKAEFAVMR AF F LP+IMGWD+++ P+L S + + EMR PDFEWGR Sbjct: 184 FSVPVTKAEFAVMRAAFSFVLPYIMGWDQVIKPKLESIGVERPMQREMRADPDFEWGR 241 >gb|OVA05795.1| Plant transcription factor [Macleaya cordata] Length = 261 Score = 77.4 bits (189), Expect = 1e-14 Identities = 36/57 (63%), Positives = 45/57 (78%), Gaps = 2/57 (3%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQL--SSAPGQMKEPEMRLSPDFEW 165 F VPV+KAEFAVMRT+F F LPHIMGWDRL Q+ S++ M++PEM+L+PD EW Sbjct: 185 FYVPVSKAEFAVMRTSFSFILPHIMGWDRLFNHQVPASTSVSPMRQPEMQLNPDLEW 241 >ref|XP_010912668.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial [Elaeis guineensis] Length = 238 Score = 77.0 bits (188), Expect = 1e-14 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQ--MKEPEMRLSPDFEWGR 171 FS+PVTKAEFAVMRTA +ALPHIMGWD+++ PQL + P + ++ PDFEWGR Sbjct: 180 FSIPVTKAEFAVMRTALSYALPHIMGWDQVIRPQLPNIPRSTPKHQSDVLPDPDFEWGR 238 >ref|XP_020107565.1| single-stranded DNA-bindig protein WHY2, mitochondrial isoform X1 [Ananas comosus] gb|OAY71645.1| Single-stranded DNA-bindig protein WHY2, mitochondrial [Ananas comosus] Length = 236 Score = 75.9 bits (185), Expect = 3e-14 Identities = 34/59 (57%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQ--MKEPEMRLSPDFEWGR 171 FSVPVT+AEF VMRTAF + LPH+MGWD+ V P+ ++ P ++ E R +PDFEWGR Sbjct: 178 FSVPVTRAEFTVMRTAFSYVLPHLMGWDQAVRPRQANTPASPLKQQVEERPNPDFEWGR 236 >gb|PIA47076.1| hypothetical protein AQUCO_01400047v1 [Aquilegia coerulea] Length = 226 Score = 73.6 bits (179), Expect = 2e-13 Identities = 36/59 (61%), Positives = 46/59 (77%), Gaps = 2/59 (3%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQ--MKEPEMRLSPDFEWGR 171 F+VPVTKAE+ VMRTAF F LPHIMGW++ +T Q+S++ Q M++ EMRLSP EW R Sbjct: 169 FAVPVTKAEYTVMRTAFSFILPHIMGWNQ-ITQQVSASSDQNPMRQQEMRLSPALEWNR 226 >ref|XP_008795280.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X4 [Phoenix dactylifera] Length = 242 Score = 73.6 bits (179), Expect = 3e-13 Identities = 34/59 (57%), Positives = 43/59 (72%), Gaps = 2/59 (3%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQ--MKEPEMRLSPDFEWGR 171 FS+PVTKAEFAVMRTA + LPHIMGWD+++ P+L + P + E+ PDFEWGR Sbjct: 184 FSLPVTKAEFAVMRTALSYVLPHIMGWDQVIGPRLPNIPQNTPRQRREVLPDPDFEWGR 242 >ref|XP_008795279.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3 [Phoenix dactylifera] Length = 243 Score = 73.6 bits (179), Expect = 3e-13 Identities = 34/59 (57%), Positives = 43/59 (72%), Gaps = 2/59 (3%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQ--MKEPEMRLSPDFEWGR 171 FS+PVTKAEFAVMRTA + LPHIMGWD+++ P+L + P + E+ PDFEWGR Sbjct: 185 FSLPVTKAEFAVMRTALSYVLPHIMGWDQVIGPRLPNIPQNTPRQRREVLPDPDFEWGR 243 >ref|XP_017699270.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 [Phoenix dactylifera] Length = 247 Score = 73.6 bits (179), Expect = 3e-13 Identities = 34/59 (57%), Positives = 43/59 (72%), Gaps = 2/59 (3%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQ--MKEPEMRLSPDFEWGR 171 FS+PVTKAEFAVMRTA + LPHIMGWD+++ P+L + P + E+ PDFEWGR Sbjct: 189 FSLPVTKAEFAVMRTALSYVLPHIMGWDQVIGPRLPNIPQNTPRQRREVLPDPDFEWGR 247 >ref|XP_017699269.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X1 [Phoenix dactylifera] Length = 248 Score = 73.6 bits (179), Expect = 3e-13 Identities = 34/59 (57%), Positives = 43/59 (72%), Gaps = 2/59 (3%) Frame = +1 Query: 1 FSVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQ--MKEPEMRLSPDFEWGR 171 FS+PVTKAEFAVMRTA + LPHIMGWD+++ P+L + P + E+ PDFEWGR Sbjct: 190 FSLPVTKAEFAVMRTALSYVLPHIMGWDQVIGPRLPNIPQNTPRQRREVLPDPDFEWGR 248 >gb|AIA25913.1| plant transcriptional regulator PBF-2, partial [Fargesia nitida] Length = 93 Score = 67.4 bits (163), Expect = 3e-12 Identities = 34/56 (60%), Positives = 37/56 (66%) Frame = +1 Query: 4 SVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQMKEPEMRLSPDFEWGR 171 SVPVTKAEFAVMRTA FALPHIMGWD+++T S K R PD EW R Sbjct: 38 SVPVTKAEFAVMRTALSFALPHIMGWDQVLTNHHPSPSSASKPRVERPHPDSEWER 93 >ref|XP_003574931.1| PREDICTED: single-stranded DNA-binding protein WHY2, mitochondrial [Brachypodium distachyon] gb|KQJ93415.1| hypothetical protein BRADI_3g04450v3 [Brachypodium distachyon] Length = 231 Score = 67.4 bits (163), Expect = 5e-11 Identities = 36/58 (62%), Positives = 40/58 (68%), Gaps = 2/58 (3%) Frame = +1 Query: 4 SVPVTKAEFAVMRTAFGFALPHIMGWDRLVT--PQLSSAPGQMKEPEMRLSPDFEWGR 171 SVPVTKAEFAVMRTA +ALPHIMGWD+ +T PQ +AP E R PD EW R Sbjct: 175 SVPVTKAEFAVMRTALSYALPHIMGWDQALTSHPQSPTAPASKPRVE-RPHPDSEWER 231 >gb|KQL28659.1| hypothetical protein SETIT_018290mg [Setaria italica] Length = 222 Score = 67.0 bits (162), Expect = 6e-11 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 4/60 (6%) Frame = +1 Query: 4 SVPVTKAEFAVMRTAFGFALPHIMGWDRLVT----PQLSSAPGQMKEPEMRLSPDFEWGR 171 SVP+TKAEFAVMRTA FALPHIMGWD+++T PQ SS P +++ P PD EW R Sbjct: 168 SVPITKAEFAVMRTALSFALPHIMGWDQVLTRHPAPQASSKP-RVERPH----PDSEWER 222 >ref|XP_004951836.1| single-stranded DNA-binding protein WHY2, mitochondrial [Setaria italica] Length = 229 Score = 67.0 bits (162), Expect = 7e-11 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 4/60 (6%) Frame = +1 Query: 4 SVPVTKAEFAVMRTAFGFALPHIMGWDRLVT----PQLSSAPGQMKEPEMRLSPDFEWGR 171 SVP+TKAEFAVMRTA FALPHIMGWD+++T PQ SS P +++ P PD EW R Sbjct: 175 SVPITKAEFAVMRTALSFALPHIMGWDQVLTRHPAPQASSKP-RVERPH----PDSEWER 229 >ref|XP_002453336.1| single-stranded DNA-binding protein WHY2, mitochondrial [Sorghum bicolor] gb|EES06312.1| hypothetical protein SORBI_3004G047500 [Sorghum bicolor] Length = 230 Score = 67.0 bits (162), Expect = 7e-11 Identities = 33/56 (58%), Positives = 36/56 (64%) Frame = +1 Query: 4 SVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQMKEPEMRLSPDFEWGR 171 SVP+TKAEFAVMRT FALPHIMGWD+ +T S P K R PD EW R Sbjct: 175 SVPITKAEFAVMRTTLSFALPHIMGWDQALTNHHPSPPAISKPRVERPHPDSEWER 230 >ref|XP_006646903.1| PREDICTED: single-stranded DNA-binding protein WHY2, mitochondrial [Oryza brachyantha] Length = 230 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = +1 Query: 4 SVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQMKEPEMRLSPDFEWGR 171 S+P+TKAEFAVMRT FALPHI+GWD+++T S P K R PD EW R Sbjct: 175 SLPITKAEFAVMRTTLSFALPHILGWDQVLTNHHPSPPAASKPRAERPHPDSEWER 230 >ref|XP_020589124.1| single-stranded DNA-binding protein WHY2, mitochondrial isoform X3 [Phalaenopsis equestris] Length = 234 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = +1 Query: 4 SVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAP-GQMKEPEMRLSPDFEWGR 171 S+PVTKAEF VMRTA GF LP IMGWDR++ P + A G ++ +++ PD EW R Sbjct: 178 SLPVTKAEFCVMRTACGFVLPLIMGWDRVIGPHVDRADHGSSEQSVVKMDPDLEWER 234 >gb|OEL22532.1| Single-stranded DNA-bindig protein WHY2, mitochondrial [Dichanthelium oligosanthes] Length = 198 Score = 65.9 bits (159), Expect = 1e-10 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = +1 Query: 4 SVPVTKAEFAVMRTAFGFALPHIMGWDRLVTPQLSSAPGQMKEPEMRLSPDFEWGR 171 SVP+TKAEFAVMRTA FALPHIMGWD+++T + P K R PD EW R Sbjct: 144 SVPITKAEFAVMRTALSFALPHIMGWDQVLTHH-PAPPASSKPRVERPHPDSEWER 198