BLASTX nr result
ID: Ophiopogon23_contig00025126
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00025126 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONM32461.1| putative Ufm1-specific protease [Zea mays] >gi|11... 114 4e-29 dbj|BAF29604.2| Os12g0285500 [Oryza sativa Japonica Group] 112 5e-29 gb|OAY77963.1| putative Ufm1-specific protease, partial [Ananas ... 109 2e-28 gb|KQL16308.1| hypothetical protein SETIT_025445mg [Setaria ital... 111 2e-28 gb|ONM32460.1| putative Ufm1-specific protease [Zea mays] >gi|11... 114 2e-28 gb|ONM32471.1| putative Ufm1-specific protease [Zea mays] 114 5e-28 gb|ONM32472.1| putative Ufm1-specific protease [Zea mays] 114 6e-28 gb|EEC69103.1| hypothetical protein OsI_38010 [Oryza sativa Indi... 112 1e-27 ref|XP_011024110.1| PREDICTED: probable Ufm1-specific protease [... 110 1e-27 ref|XP_020253328.1| probable Ufm1-specific protease isoform X3 [... 114 2e-27 ref|XP_009403636.1| PREDICTED: probable Ufm1-specific protease [... 115 3e-27 ref|XP_020253327.1| probable Ufm1-specific protease isoform X2 [... 114 4e-27 gb|KQL16307.1| hypothetical protein SETIT_025445mg [Setaria ital... 111 4e-27 ref|XP_020253326.1| probable Ufm1-specific protease isoform X1 [... 114 4e-27 gb|PKI66630.1| hypothetical protein CRG98_012972 [Punica granatum] 108 5e-27 gb|ONM32470.1| putative Ufm1-specific protease [Zea mays] 114 5e-27 gb|ONM32469.1| putative Ufm1-specific protease [Zea mays] 114 5e-27 ref|XP_023157745.1| probable Ufm1-specific protease isoform X2 [... 114 5e-27 ref|XP_021320472.1| probable Ufm1-specific protease isoform X2 [... 114 5e-27 ref|XP_008674222.1| probable Ufm1-specific protease isoform X1 [... 114 5e-27 >gb|ONM32461.1| putative Ufm1-specific protease [Zea mays] gb|ONM32464.1| putative Ufm1-specific protease [Zea mays] Length = 224 Score = 114 bits (285), Expect = 4e-29 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+GTDDLKKIVNGGWCGWKK+VDSKGR+FFLKDKFYNLLLPQRPNMV Sbjct: 172 LILDPHYTGTDDLKKIVNGGWCGWKKSVDSKGRSFFLKDKFYNLLLPQRPNMV 224 >dbj|BAF29604.2| Os12g0285500 [Oryza sativa Japonica Group] Length = 155 Score = 112 bits (279), Expect = 5e-29 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+G DDLKKIVNGGWCGWKK++DSKGR+FFLKDKFYNLLLPQRPNMV Sbjct: 103 LILDPHYTGADDLKKIVNGGWCGWKKSIDSKGRSFFLKDKFYNLLLPQRPNMV 155 >gb|OAY77963.1| putative Ufm1-specific protease, partial [Ananas comosus] Length = 128 Score = 109 bits (273), Expect = 2e-28 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+G DDLKKI++GGWCGWKKAVD+KGR+FFLKDKFYNLLLPQRPNMV Sbjct: 76 LILDPHYTGKDDLKKIISGGWCGWKKAVDNKGRSFFLKDKFYNLLLPQRPNMV 128 >gb|KQL16308.1| hypothetical protein SETIT_025445mg [Setaria italica] Length = 179 Score = 111 bits (277), Expect = 2e-28 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+G DDLKKIVNGGWCGWKK+VD+KGR+FFLKDKFYNLLLPQRPNMV Sbjct: 127 LILDPHYTGADDLKKIVNGGWCGWKKSVDNKGRSFFLKDKFYNLLLPQRPNMV 179 >gb|ONM32460.1| putative Ufm1-specific protease [Zea mays] gb|ONM32466.1| putative Ufm1-specific protease [Zea mays] Length = 307 Score = 114 bits (285), Expect = 2e-28 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+GTDDLKKIVNGGWCGWKK+VDSKGR+FFLKDKFYNLLLPQRPNMV Sbjct: 255 LILDPHYTGTDDLKKIVNGGWCGWKKSVDSKGRSFFLKDKFYNLLLPQRPNMV 307 >gb|ONM32471.1| putative Ufm1-specific protease [Zea mays] Length = 351 Score = 114 bits (285), Expect = 5e-28 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+GTDDLKKIVNGGWCGWKK+VDSKGR+FFLKDKFYNLLLPQRPNMV Sbjct: 299 LILDPHYTGTDDLKKIVNGGWCGWKKSVDSKGRSFFLKDKFYNLLLPQRPNMV 351 >gb|ONM32472.1| putative Ufm1-specific protease [Zea mays] Length = 363 Score = 114 bits (285), Expect = 6e-28 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+GTDDLKKIVNGGWCGWKK+VDSKGR+FFLKDKFYNLLLPQRPNMV Sbjct: 311 LILDPHYTGTDDLKKIVNGGWCGWKKSVDSKGRSFFLKDKFYNLLLPQRPNMV 363 >gb|EEC69103.1| hypothetical protein OsI_38010 [Oryza sativa Indica Group] Length = 275 Score = 112 bits (279), Expect = 1e-27 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+G DDLKKIVNGGWCGWKK++DSKGR+FFLKDKFYNLLLPQRPNMV Sbjct: 223 LILDPHYTGADDLKKIVNGGWCGWKKSIDSKGRSFFLKDKFYNLLLPQRPNMV 275 >ref|XP_011024110.1| PREDICTED: probable Ufm1-specific protease [Populus euphratica] Length = 223 Score = 110 bits (275), Expect = 1e-27 Identities = 49/53 (92%), Positives = 50/53 (94%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+G DD KKIVNGGWCGWKKAVDSKGRNFFL DKFYNLLLPQRPNMV Sbjct: 171 LILDPHYTGNDDHKKIVNGGWCGWKKAVDSKGRNFFLHDKFYNLLLPQRPNMV 223 >ref|XP_020253328.1| probable Ufm1-specific protease isoform X3 [Asparagus officinalis] ref|XP_020253329.1| probable Ufm1-specific protease isoform X3 [Asparagus officinalis] Length = 529 Score = 114 bits (286), Expect = 2e-27 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+G DDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV Sbjct: 477 LILDPHYTGGDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 529 >ref|XP_009403636.1| PREDICTED: probable Ufm1-specific protease [Musa acuminata subsp. malaccensis] Length = 649 Score = 115 bits (287), Expect = 3e-27 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+G DDLKKIVNGGWCGWKKA+DSKGRNFFLKDKFYNLLLPQRPNMV Sbjct: 597 LILDPHYTGNDDLKKIVNGGWCGWKKAIDSKGRNFFLKDKFYNLLLPQRPNMV 649 >ref|XP_020253327.1| probable Ufm1-specific protease isoform X2 [Asparagus officinalis] Length = 629 Score = 114 bits (286), Expect = 4e-27 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+G DDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV Sbjct: 577 LILDPHYTGGDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 629 >gb|KQL16307.1| hypothetical protein SETIT_025445mg [Setaria italica] Length = 307 Score = 111 bits (277), Expect = 4e-27 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+G DDLKKIVNGGWCGWKK+VD+KGR+FFLKDKFYNLLLPQRPNMV Sbjct: 255 LILDPHYTGADDLKKIVNGGWCGWKKSVDNKGRSFFLKDKFYNLLLPQRPNMV 307 >ref|XP_020253326.1| probable Ufm1-specific protease isoform X1 [Asparagus officinalis] gb|ONK77667.1| uncharacterized protein A4U43_C02F9200 [Asparagus officinalis] Length = 642 Score = 114 bits (286), Expect = 4e-27 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+G DDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV Sbjct: 590 LILDPHYTGGDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 642 >gb|PKI66630.1| hypothetical protein CRG98_012972 [Punica granatum] Length = 223 Score = 108 bits (271), Expect = 5e-27 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+GTDD KKI+NGGWCGWKKAVDSKG+NFFL DKFYNLLLPQRP+MV Sbjct: 171 LILDPHYTGTDDHKKIINGGWCGWKKAVDSKGKNFFLHDKFYNLLLPQRPDMV 223 >gb|ONM32470.1| putative Ufm1-specific protease [Zea mays] Length = 637 Score = 114 bits (285), Expect = 5e-27 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+GTDDLKKIVNGGWCGWKK+VDSKGR+FFLKDKFYNLLLPQRPNMV Sbjct: 585 LILDPHYTGTDDLKKIVNGGWCGWKKSVDSKGRSFFLKDKFYNLLLPQRPNMV 637 >gb|ONM32469.1| putative Ufm1-specific protease [Zea mays] Length = 639 Score = 114 bits (285), Expect = 5e-27 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+GTDDLKKIVNGGWCGWKK+VDSKGR+FFLKDKFYNLLLPQRPNMV Sbjct: 587 LILDPHYTGTDDLKKIVNGGWCGWKKSVDSKGRSFFLKDKFYNLLLPQRPNMV 639 >ref|XP_023157745.1| probable Ufm1-specific protease isoform X2 [Zea mays] Length = 641 Score = 114 bits (285), Expect = 5e-27 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+GTDDLKKIVNGGWCGWKK+VDSKGR+FFLKDKFYNLLLPQRPNMV Sbjct: 589 LILDPHYTGTDDLKKIVNGGWCGWKKSVDSKGRSFFLKDKFYNLLLPQRPNMV 641 >ref|XP_021320472.1| probable Ufm1-specific protease isoform X2 [Sorghum bicolor] gb|OQU80169.1| hypothetical protein SORBI_3007G090430 [Sorghum bicolor] Length = 643 Score = 114 bits (285), Expect = 5e-27 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+GTDDLKKIVNGGWCGWKK+VDSKGR+FFLKDKFYNLLLPQRPNMV Sbjct: 591 LILDPHYTGTDDLKKIVNGGWCGWKKSVDSKGRSFFLKDKFYNLLLPQRPNMV 643 >ref|XP_008674222.1| probable Ufm1-specific protease isoform X1 [Zea mays] gb|ONM32453.1| putative Ufm1-specific protease [Zea mays] Length = 643 Score = 114 bits (285), Expect = 5e-27 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = -3 Query: 366 LILDPHYSGTDDLKKIVNGGWCGWKKAVDSKGRNFFLKDKFYNLLLPQRPNMV 208 LILDPHY+GTDDLKKIVNGGWCGWKK+VDSKGR+FFLKDKFYNLLLPQRPNMV Sbjct: 591 LILDPHYTGTDDLKKIVNGGWCGWKKSVDSKGRSFFLKDKFYNLLLPQRPNMV 643