BLASTX nr result
ID: Ophiopogon23_contig00024387
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00024387 (399 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020246983.1| putative pentatricopeptide repeat-containing... 76 2e-13 gb|POE85657.1| putative pentatricopeptide repeat-containing prot... 58 5e-07 ref|XP_023872592.1| putative pentatricopeptide repeat-containing... 58 5e-07 gb|KRH06837.1| hypothetical protein GLYMA_16G049100 [Glycine max] 54 8e-06 >ref|XP_020246983.1| putative pentatricopeptide repeat-containing protein At2g01510 [Asparagus officinalis] gb|ONK58617.1| uncharacterized protein A4U43_C09F14900 [Asparagus officinalis] Length = 809 Score = 76.3 bits (186), Expect = 2e-13 Identities = 40/70 (57%), Positives = 50/70 (71%) Frame = -3 Query: 211 MKPFRKTNSVPAICSLASNSITKRPIHGDSQMIKTGFNPQTYNFNHQIAAHFKCLGPSHV 32 M+PF+ T + PAI SL SN KR IH D+QMIKTGFNPQTY+ N QI++ G S Sbjct: 1 MRPFKPT-AFPAISSLTSNPTIKRSIHVDAQMIKTGFNPQTYDSNLQISSLINSGGISKA 59 Query: 31 RKLFDEMPNK 2 R+LFD+MP+K Sbjct: 60 RELFDKMPHK 69 >gb|POE85657.1| putative pentatricopeptide repeat-containing protein [Quercus suber] Length = 530 Score = 57.8 bits (138), Expect = 5e-07 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 5/75 (6%) Frame = -3 Query: 211 MKPFRKTNSVPAICSLASNSITKRPIHG-----DSQMIKTGFNPQTYNFNHQIAAHFKCL 47 MKP + N++ SL ++ +K P++ D+++IKTGFNPQT FN ++ + Sbjct: 1 MKPLHRANALQTFASLRASQSSKLPLNDVHHFIDARIIKTGFNPQTCRFNFRVNDFLQRG 60 Query: 46 GPSHVRKLFDEMPNK 2 SH R+LFD+MP K Sbjct: 61 ELSHARQLFDQMPQK 75 >ref|XP_023872592.1| putative pentatricopeptide repeat-containing protein At2g01510 [Quercus suber] Length = 819 Score = 57.8 bits (138), Expect = 5e-07 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 5/75 (6%) Frame = -3 Query: 211 MKPFRKTNSVPAICSLASNSITKRPIHG-----DSQMIKTGFNPQTYNFNHQIAAHFKCL 47 MKP + N++ SL ++ +K P++ D+++IKTGFNPQT FN ++ + Sbjct: 1 MKPLHRANALQTFASLRASQSSKLPLNDVHHFIDARIIKTGFNPQTCRFNFRVNDFLQRG 60 Query: 46 GPSHVRKLFDEMPNK 2 SH R+LFD+MP K Sbjct: 61 ELSHARQLFDQMPQK 75 >gb|KRH06837.1| hypothetical protein GLYMA_16G049100 [Glycine max] Length = 765 Score = 54.3 bits (129), Expect = 8e-06 Identities = 26/54 (48%), Positives = 34/54 (62%) Frame = -3 Query: 163 ASNSITKRPIHGDSQMIKTGFNPQTYNFNHQIAAHFKCLGPSHVRKLFDEMPNK 2 A S KR ++ D+ MIKTGF+P TY +N Q+ H + RKLFDEMP+K Sbjct: 13 ALTSSPKRHLYVDASMIKTGFDPNTYRYNFQVQIHLQRGDLGAARKLFDEMPHK 66