BLASTX nr result
ID: Ophiopogon23_contig00024101
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00024101 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM44770.1| hypothetical protein LR48_Vigan06g007600 [Vigna a... 88 2e-19 gb|PKI49492.1| hypothetical protein CRG98_030109, partial [Punic... 89 2e-19 ref|XP_008798524.1| PREDICTED: uncharacterized protein LOC103713... 92 5e-19 ref|XP_021630796.1| uncharacterized protein LOC110628432 isoform... 91 7e-19 ref|XP_021630790.1| uncharacterized protein LOC110628432 isoform... 91 7e-19 ref|XP_021630785.1| uncharacterized protein LOC110628432 isoform... 91 7e-19 ref|XP_019705769.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 91 7e-19 ref|XP_021630776.1| uncharacterized protein LOC110628432 isoform... 91 7e-19 ref|XP_015083170.1| PREDICTED: uncharacterized protein LOC107026... 91 7e-19 ref|XP_004246139.1| PREDICTED: uncharacterized protein LOC101245... 91 7e-19 ref|XP_015159057.1| PREDICTED: uncharacterized protein LOC102606... 91 7e-19 gb|KHN42722.1| Deoxyribodipyrimidine photo-lyase [Glycine soja] 89 1e-18 gb|KDP25589.1| hypothetical protein JCGZ_20745 [Jatropha curcas] 90 2e-18 ref|XP_020539572.1| uncharacterized protein LOC105645948 [Jatrop... 90 2e-18 gb|OAY71898.1| hypothetical protein ACMD2_24920 [Ananas comosus] 90 3e-18 ref|XP_006590548.1| PREDICTED: uncharacterized protein LOC102663... 89 3e-18 ref|XP_007158414.1| hypothetical protein PHAVU_002G151000g [Phas... 89 3e-18 ref|XP_003516674.1| PREDICTED: uncharacterized protein LOC100802... 89 3e-18 gb|OIT27100.1| hypothetical protein A4A49_65914, partial [Nicoti... 89 3e-18 ref|XP_010277356.1| PREDICTED: uncharacterized protein LOC104611... 89 3e-18 >gb|KOM44770.1| hypothetical protein LR48_Vigan06g007600 [Vigna angularis] Length = 173 Score = 88.2 bits (217), Expect = 2e-19 Identities = 42/48 (87%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EP+LL + ETGLP+AVKLRCSLCDAVFSASNPSRTA+EHLKRGTCPNF Sbjct: 48 EPMLLHNTETGLPKAVKLRCSLCDAVFSASNPSRTATEHLKRGTCPNF 95 >gb|PKI49492.1| hypothetical protein CRG98_030109, partial [Punica granatum] Length = 212 Score = 89.0 bits (219), Expect = 2e-19 Identities = 42/48 (87%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQ-SETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EP+L+ S+TGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 114 EPVLVHNSDTGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 161 >ref|XP_008798524.1| PREDICTED: uncharacterized protein LOC103713392 [Phoenix dactylifera] Length = 806 Score = 91.7 bits (226), Expect = 5e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +3 Query: 3 EPILLQSETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EP+L S+TGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 58 EPMLQSSDTGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 104 >ref|XP_021630796.1| uncharacterized protein LOC110628432 isoform X4 [Manihot esculenta] gb|OAY59932.1| hypothetical protein MANES_01G072200 [Manihot esculenta] Length = 781 Score = 91.3 bits (225), Expect = 7e-19 Identities = 44/48 (91%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EPIL+Q+ ETGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 53 EPILVQNTETGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 100 >ref|XP_021630790.1| uncharacterized protein LOC110628432 isoform X3 [Manihot esculenta] gb|OAY59931.1| hypothetical protein MANES_01G072200 [Manihot esculenta] Length = 783 Score = 91.3 bits (225), Expect = 7e-19 Identities = 44/48 (91%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EPIL+Q+ ETGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 53 EPILVQNTETGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 100 >ref|XP_021630785.1| uncharacterized protein LOC110628432 isoform X2 [Manihot esculenta] Length = 795 Score = 91.3 bits (225), Expect = 7e-19 Identities = 44/48 (91%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EPIL+Q+ ETGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 53 EPILVQNTETGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 100 >ref|XP_019705769.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105042719 [Elaeis guineensis] Length = 797 Score = 91.3 bits (225), Expect = 7e-19 Identities = 44/48 (91%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EPIL+QS +TGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 58 EPILVQSSDTGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 105 >ref|XP_021630776.1| uncharacterized protein LOC110628432 isoform X1 [Manihot esculenta] Length = 802 Score = 91.3 bits (225), Expect = 7e-19 Identities = 44/48 (91%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EPIL+Q+ ETGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 53 EPILVQNTETGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 100 >ref|XP_015083170.1| PREDICTED: uncharacterized protein LOC107026639 [Solanum pennellii] Length = 819 Score = 91.3 bits (225), Expect = 7e-19 Identities = 44/48 (91%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQ-SETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EPIL+Q S+TGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 62 EPILVQNSDTGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 109 >ref|XP_004246139.1| PREDICTED: uncharacterized protein LOC101245086 [Solanum lycopersicum] Length = 821 Score = 91.3 bits (225), Expect = 7e-19 Identities = 44/48 (91%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQ-SETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EPIL+Q S+TGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 64 EPILVQNSDTGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 111 >ref|XP_015159057.1| PREDICTED: uncharacterized protein LOC102606051 [Solanum tuberosum] Length = 825 Score = 91.3 bits (225), Expect = 7e-19 Identities = 44/48 (91%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQ-SETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EPIL+Q S+TGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 67 EPILVQNSDTGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 114 >gb|KHN42722.1| Deoxyribodipyrimidine photo-lyase [Glycine soja] Length = 351 Score = 89.4 bits (220), Expect = 1e-18 Identities = 43/48 (89%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EP+LL + ETGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 48 EPMLLHNTETGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 95 >gb|KDP25589.1| hypothetical protein JCGZ_20745 [Jatropha curcas] Length = 780 Score = 90.1 bits (222), Expect = 2e-18 Identities = 43/48 (89%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EP+L+Q+ ETGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 53 EPMLVQNAETGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 100 >ref|XP_020539572.1| uncharacterized protein LOC105645948 [Jatropha curcas] Length = 820 Score = 90.1 bits (222), Expect = 2e-18 Identities = 43/48 (89%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EP+L+Q+ ETGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 91 EPMLVQNAETGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 138 >gb|OAY71898.1| hypothetical protein ACMD2_24920 [Ananas comosus] Length = 791 Score = 89.7 bits (221), Expect = 3e-18 Identities = 43/48 (89%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EPIL+QS +TGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRG+CPNF Sbjct: 55 EPILVQSSDTGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGSCPNF 102 >ref|XP_006590548.1| PREDICTED: uncharacterized protein LOC102663387 [Glycine max] gb|KRH28018.1| hypothetical protein GLYMA_11G029400 [Glycine max] Length = 731 Score = 89.4 bits (220), Expect = 3e-18 Identities = 43/48 (89%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EP+LL + ETGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 48 EPMLLHNTETGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 95 >ref|XP_007158414.1| hypothetical protein PHAVU_002G151000g [Phaseolus vulgaris] gb|ESW30408.1| hypothetical protein PHAVU_002G151000g [Phaseolus vulgaris] Length = 744 Score = 89.4 bits (220), Expect = 3e-18 Identities = 43/48 (89%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EP+LL + ETGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 43 EPMLLHNTETGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 90 >ref|XP_003516674.1| PREDICTED: uncharacterized protein LOC100802491 [Glycine max] gb|KRH77421.1| hypothetical protein GLYMA_01G212400 [Glycine max] Length = 750 Score = 89.4 bits (220), Expect = 3e-18 Identities = 43/48 (89%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQS-ETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EP+LL + ETGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 48 EPMLLHNTETGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 95 >gb|OIT27100.1| hypothetical protein A4A49_65914, partial [Nicotiana attenuata] Length = 763 Score = 89.4 bits (220), Expect = 3e-18 Identities = 43/48 (89%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQ-SETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EPIL+ S+TGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 35 EPILVHNSDTGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 82 >ref|XP_010277356.1| PREDICTED: uncharacterized protein LOC104611827 [Nelumbo nucifera] Length = 775 Score = 89.4 bits (220), Expect = 3e-18 Identities = 43/48 (89%), Positives = 46/48 (95%), Gaps = 1/48 (2%) Frame = +3 Query: 3 EPILLQ-SETGLPRAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 143 EPIL+ S+TGLP+AVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF Sbjct: 53 EPILVHNSDTGLPKAVKLRCSLCDAVFSASNPSRTASEHLKRGTCPNF 100