BLASTX nr result
ID: Ophiopogon23_contig00024018
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00024018 (1074 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010937677.1| PREDICTED: putative pentatricopeptide repeat... 63 1e-13 ref|XP_020582349.1| putative pentatricopeptide repeat-containing... 57 1e-13 ref|XP_020086399.1| putative pentatricopeptide repeat-containing... 64 1e-12 ref|XP_020676088.1| putative pentatricopeptide repeat-containing... 52 2e-12 gb|PIA38988.1| hypothetical protein AQUCO_02700279v1 [Aquilegia ... 50 2e-11 ref|XP_022846982.1| putative pentatricopeptide repeat-containing... 52 4e-11 ref|XP_018502404.1| PREDICTED: putative pentatricopeptide repeat... 50 3e-10 ref|XP_021977778.1| putative pentatricopeptide repeat-containing... 51 4e-10 ref|XP_008385145.1| PREDICTED: putative pentatricopeptide repeat... 49 5e-10 ref|XP_020421067.1| putative pentatricopeptide repeat-containing... 48 7e-10 ref|XP_008223144.1| PREDICTED: putative pentatricopeptide repeat... 48 7e-10 ref|XP_024157952.1| putative pentatricopeptide repeat-containing... 47 9e-10 ref|XP_024157953.1| putative pentatricopeptide repeat-containing... 47 9e-10 ref|XP_009801698.1| PREDICTED: putative pentatricopeptide repeat... 49 2e-09 ref|XP_019150138.1| PREDICTED: putative pentatricopeptide repeat... 47 2e-09 ref|XP_004295933.2| PREDICTED: putative pentatricopeptide repeat... 48 3e-09 ref|XP_021820348.1| putative pentatricopeptide repeat-containing... 47 3e-09 ref|XP_019263026.1| PREDICTED: putative pentatricopeptide repeat... 48 3e-09 ref|XP_015058255.1| PREDICTED: putative pentatricopeptide repeat... 47 3e-09 ref|XP_004251458.1| PREDICTED: putative pentatricopeptide repeat... 47 3e-09 >ref|XP_010937677.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Elaeis guineensis] ref|XP_010937679.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Elaeis guineensis] ref|XP_010937680.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Elaeis guineensis] Length = 912 Score = 63.2 bits (152), Expect(2) = 1e-13 Identities = 35/66 (53%), Positives = 46/66 (69%) Frame = +1 Query: 283 LWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFDE 462 L F+FLI AY+ R+ DA+ +L L +G L EVRTF+DVM L K+RRF+L + VFDE Sbjct: 155 LGFDFLIQAYLQCRRELDALAILELTIGSGLLPEVRTFSDVMYGLAKIRRFDLVSGVFDE 214 Query: 463 GLLRLG 480 +LR G Sbjct: 215 -VLRSG 219 Score = 43.1 bits (100), Expect(2) = 1e-13 Identities = 27/60 (45%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +3 Query: 90 PCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITS-LEAFK 266 P L F N+LGLH F S LSF IL L++ LHW LQTL S + T+ +AF+ Sbjct: 81 PRLALRFFNFLGLHRGFPHSPLSFSILSLALLRAGLHWPASSLLQTLASCRATAPADAFR 140 >ref|XP_020582349.1| putative pentatricopeptide repeat-containing protein At5g59900 [Phalaenopsis equestris] Length = 947 Score = 56.6 bits (135), Expect(2) = 1e-13 Identities = 30/57 (52%), Positives = 41/57 (71%) Frame = +1 Query: 292 NFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFDE 462 +FLI AYIH R DA+ VL L++ + EVRTF++V+ L+K+RRF+LA VFDE Sbjct: 183 DFLIQAYIHARRILDALAVLRLSLPAGMAPEVRTFSEVIVGLVKIRRFDLAIQVFDE 239 Score = 49.3 bits (116), Expect(2) = 1e-13 Identities = 25/59 (42%), Positives = 35/59 (59%) Frame = +3 Query: 87 RPCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAF 263 +P L F N+LGLHL F S L F +LV +L+++ LHW LQ+L+ + EAF Sbjct: 107 QPRLALRFFNFLGLHLRFPHSPLCFFLLVHSLLRYGLHWPASSLLQSLVCRPTSPAEAF 165 >ref|XP_020086399.1| putative pentatricopeptide repeat-containing protein At5g59900 [Ananas comosus] ref|XP_020086400.1| putative pentatricopeptide repeat-containing protein At5g59900 [Ananas comosus] ref|XP_020086401.1| putative pentatricopeptide repeat-containing protein At5g59900 [Ananas comosus] ref|XP_020086402.1| putative pentatricopeptide repeat-containing protein At5g59900 [Ananas comosus] Length = 932 Score = 63.5 bits (153), Expect(2) = 1e-12 Identities = 32/58 (55%), Positives = 41/58 (70%) Frame = +1 Query: 289 FNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFDE 462 F+FLI AYI + R DA VL L++GLEL E RT +DVM +L K+RRF +A VFD+ Sbjct: 177 FDFLIQAYIKDRRALDAFTVLRLSIGLELCPEARTVSDVMFLLAKIRRFGMAAKVFDD 234 Score = 39.3 bits (90), Expect(2) = 1e-12 Identities = 24/58 (41%), Positives = 30/58 (51%) Frame = +3 Query: 90 PCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAF 263 P L F N+L L F S LSF IL ++ +W LQTLIS+ I+ EAF Sbjct: 102 PRLAHRFFNHLALSHRFPHSPLSFAILAHAFLRLGPNWLAASLLQTLISTPISPSEAF 159 >ref|XP_020676088.1| putative pentatricopeptide repeat-containing protein At5g59900 [Dendrobium catenatum] gb|PKU85567.1| Putative pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 916 Score = 52.0 bits (123), Expect(2) = 2e-12 Identities = 26/57 (45%), Positives = 39/57 (68%) Frame = +1 Query: 292 NFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFDE 462 +FLI AYI DA+ +L L++ + EVRTF+D++N L+K+RRF+ A VFD+ Sbjct: 154 DFLIEAYIQARHVLDALAILRLSMSAGMIPEVRTFSDLINGLVKIRRFDRAVQVFDD 210 Score = 50.1 bits (118), Expect(2) = 2e-12 Identities = 27/59 (45%), Positives = 35/59 (59%) Frame = +3 Query: 87 RPCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAF 263 +P L F N+LGLHL F S L F ILV +L++ LHW LQ+L+S + EAF Sbjct: 77 QPRLALRFFNFLGLHLRFPHSPLCFFILVHSLLRSGLHWPASSLLQSLVSRPTSPAEAF 135 >gb|PIA38988.1| hypothetical protein AQUCO_02700279v1 [Aquilegia coerulea] gb|PIA38989.1| hypothetical protein AQUCO_02700279v1 [Aquilegia coerulea] Length = 907 Score = 49.7 bits (117), Expect(2) = 2e-11 Identities = 26/65 (40%), Positives = 38/65 (58%) Frame = +3 Query: 90 PCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAFK* 269 P L F N+LGLH F SNLSF IL+ +LV+ +L+W + +QT + + S + F Sbjct: 80 PKLALRFFNFLGLHRNFQHSNLSFCILIHSLVQCNLNWPAISIIQTFLLRGLNSKQVFDS 139 Query: 270 NLIEF 284 LI + Sbjct: 140 LLIAY 144 Score = 48.9 bits (115), Expect(2) = 2e-11 Identities = 25/61 (40%), Positives = 41/61 (67%) Frame = +1 Query: 280 NLWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFD 459 +L F+FLI +YI + R +DA+ ++ L EVRT ++V+N L+++RRF++A VF Sbjct: 152 SLGFDFLIQSYIQSKRVFDAVSIVKFMGQNGLVPEVRTISEVLNGLVRIRRFDMALDVFY 211 Query: 460 E 462 E Sbjct: 212 E 212 >ref|XP_022846982.1| putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Olea europaea var. sylvestris] Length = 915 Score = 52.4 bits (124), Expect(2) = 4e-11 Identities = 24/58 (41%), Positives = 40/58 (68%) Frame = +1 Query: 289 FNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFDE 462 F+ LI +Y+ N R D++ ++ L G + EVRTF+ V++ L+KVR+FN+ ++FDE Sbjct: 163 FDLLIQSYVQNRRVLDSVLIVKLMKGCNVFPEVRTFSAVLHRLVKVRQFNMVISLFDE 220 Score = 45.1 bits (105), Expect(2) = 4e-11 Identities = 20/42 (47%), Positives = 28/42 (66%) Frame = +3 Query: 108 FINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLI 233 F N+LGLH FH S +SF I+V +LV+ + +W LQTL+ Sbjct: 94 FFNFLGLHRDFHHSTMSFCIMVHSLVQSNFYWPASSLLQTLL 135 >ref|XP_018502404.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Pyrus x bretschneideri] Length = 907 Score = 50.1 bits (118), Expect(2) = 3e-10 Identities = 25/58 (43%), Positives = 35/58 (60%) Frame = +1 Query: 289 FNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFDE 462 F+ L+ Y+ N R D + V+ L EL EVRT N ++N L+K+R FNL +FDE Sbjct: 162 FDLLVQGYVQNKRVLDGVLVVRLMRECELLPEVRTLNALLNGLVKIRHFNLVLQLFDE 219 Score = 44.3 bits (103), Expect(2) = 3e-10 Identities = 24/61 (39%), Positives = 33/61 (54%) Frame = +3 Query: 84 QRPCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAF 263 + P L F N+LGLH F S SF IL+ LV+ +L W LQTL+ ++ E F Sbjct: 85 RNPRLALRFFNFLGLHRSFGHSTASFCILIHALVQGNLFWPASSLLQTLLLRGLSPSEVF 144 Query: 264 K 266 + Sbjct: 145 Q 145 >ref|XP_021977778.1| putative pentatricopeptide repeat-containing protein At5g59900 [Helianthus annuus] gb|OTG18877.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 892 Score = 50.8 bits (120), Expect(2) = 4e-10 Identities = 27/60 (45%), Positives = 37/60 (61%) Frame = +1 Query: 283 LWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFDE 462 L F+ L+ AY+ + R D+ VLNL L EVRT +DV N L+++RRF+L FDE Sbjct: 153 LGFDLLVNAYVQSKRFLDSFTVLNLMKERSLMPEVRTVSDVFNGLIRIRRFDLVLRFFDE 212 Score = 43.1 bits (100), Expect(2) = 4e-10 Identities = 22/48 (45%), Positives = 28/48 (58%) Frame = +3 Query: 90 PCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLI 233 P L F NYLGLH FH S SF IL+ +LV+ + W +QTL+ Sbjct: 80 PRLALRFFNYLGLHKHFHHSTTSFCILIHSLVQSNYLWPASSLIQTLL 127 >ref|XP_008385145.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Malus domestica] Length = 908 Score = 49.3 bits (116), Expect(2) = 5e-10 Identities = 24/58 (41%), Positives = 35/58 (60%) Frame = +1 Query: 289 FNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFDE 462 F+ L+ Y+ N R D + V+ L E+ EVRT N ++N L+K+R FNL +FDE Sbjct: 163 FDLLVQGYVQNKRVLDGVLVVRLMRECEMLPEVRTLNALLNGLVKIRHFNLVLQLFDE 220 Score = 44.3 bits (103), Expect(2) = 5e-10 Identities = 24/61 (39%), Positives = 32/61 (52%) Frame = +3 Query: 84 QRPCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAF 263 + P L F N+LGLH F S SF IL+ LV+ +L W LQTL+ + E F Sbjct: 86 RNPRLALRFFNFLGLHRSFSHSTASFCILIHALVQGNLFWPASSLLQTLLLRGLNPSEVF 145 Query: 264 K 266 + Sbjct: 146 Q 146 >ref|XP_020421067.1| putative pentatricopeptide repeat-containing protein At5g59900 [Prunus persica] gb|ONI00318.1| hypothetical protein PRUPE_6G082100 [Prunus persica] Length = 912 Score = 48.1 bits (113), Expect(2) = 7e-10 Identities = 23/61 (37%), Positives = 37/61 (60%) Frame = +1 Query: 280 NLWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFD 459 +L F+ L+ Y+ N R D + V+ L E+ EVRT N ++N L+++R FN+ +FD Sbjct: 156 SLGFDLLVQNYVQNKRVLDGVVVVRLMRECEILAEVRTLNALLNGLVRIRHFNMVLQLFD 215 Query: 460 E 462 E Sbjct: 216 E 216 Score = 45.1 bits (105), Expect(2) = 7e-10 Identities = 24/61 (39%), Positives = 33/61 (54%) Frame = +3 Query: 84 QRPCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAF 263 + P L F N+LGLH F+ S SF IL+ LV+ +L W LQTL+ + E F Sbjct: 82 RNPRLALRFFNFLGLHKSFNHSTASFCILIHALVQSNLFWPASSLLQTLLLRGLNPNEVF 141 Query: 264 K 266 + Sbjct: 142 Q 142 >ref|XP_008223144.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Prunus mume] Length = 892 Score = 48.1 bits (113), Expect(2) = 7e-10 Identities = 23/61 (37%), Positives = 37/61 (60%) Frame = +1 Query: 280 NLWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFD 459 +L F+ L+ Y+ N R D + V+ L E+ EVRT N ++N L+++R FN+ +FD Sbjct: 156 SLGFDLLVQNYVQNKRVLDGVVVVRLMRECEILAEVRTLNALLNGLVRIRHFNMVLQLFD 215 Query: 460 E 462 E Sbjct: 216 E 216 Score = 45.1 bits (105), Expect(2) = 7e-10 Identities = 24/61 (39%), Positives = 33/61 (54%) Frame = +3 Query: 84 QRPCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAF 263 + P L F N+LGLH F+ S SF IL+ LV+ +L W LQTL+ + E F Sbjct: 82 RNPRLALRFFNFLGLHKSFNHSTASFCILIHALVQSNLFWPASSLLQTLLLRGLNPNEVF 141 Query: 264 K 266 + Sbjct: 142 Q 142 >ref|XP_024157952.1| putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Rosa chinensis] Length = 904 Score = 47.0 bits (110), Expect(2) = 9e-10 Identities = 22/61 (36%), Positives = 38/61 (62%) Frame = +1 Query: 280 NLWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFD 459 +L F+ L+ Y+ N R D + V++L ++ EVRT N ++N L+++R FN+ +FD Sbjct: 156 SLGFDLLVQNYVQNKRVLDGVVVVSLMRECKMVPEVRTLNALLNGLVRIRHFNMVLQLFD 215 Query: 460 E 462 E Sbjct: 216 E 216 Score = 45.8 bits (107), Expect(2) = 9e-10 Identities = 24/61 (39%), Positives = 32/61 (52%) Frame = +3 Query: 84 QRPCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAF 263 + P L F N+LGLH F+ S SF IL+ LV+ L W LQTL+ + E F Sbjct: 82 RNPRLALRFFNFLGLHKSFNHSTASFCILIHALVQCSLFWPATSLLQTLLLRGLNPTEVF 141 Query: 264 K 266 + Sbjct: 142 R 142 >ref|XP_024157953.1| putative pentatricopeptide repeat-containing protein At5g59900 isoform X2 [Rosa chinensis] Length = 813 Score = 47.0 bits (110), Expect(2) = 9e-10 Identities = 22/61 (36%), Positives = 38/61 (62%) Frame = +1 Query: 280 NLWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFD 459 +L F+ L+ Y+ N R D + V++L ++ EVRT N ++N L+++R FN+ +FD Sbjct: 156 SLGFDLLVQNYVQNKRVLDGVVVVSLMRECKMVPEVRTLNALLNGLVRIRHFNMVLQLFD 215 Query: 460 E 462 E Sbjct: 216 E 216 Score = 45.8 bits (107), Expect(2) = 9e-10 Identities = 24/61 (39%), Positives = 32/61 (52%) Frame = +3 Query: 84 QRPCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAF 263 + P L F N+LGLH F+ S SF IL+ LV+ L W LQTL+ + E F Sbjct: 82 RNPRLALRFFNFLGLHKSFNHSTASFCILIHALVQCSLFWPATSLLQTLLLRGLNPTEVF 141 Query: 264 K 266 + Sbjct: 142 R 142 >ref|XP_009801698.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Nicotiana sylvestris] ref|XP_009801699.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Nicotiana sylvestris] ref|XP_009801700.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Nicotiana sylvestris] ref|XP_016469024.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Nicotiana tabacum] ref|XP_016469025.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Nicotiana tabacum] ref|XP_016469026.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Nicotiana tabacum] Length = 891 Score = 48.9 bits (115), Expect(2) = 2e-09 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = +3 Query: 108 FINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLI 233 F N+LGLH FH SN SF ILV +LV+ +L+W LQTL+ Sbjct: 81 FFNFLGLHKNFHHSNASFCILVHSLVQSNLYWPATSLLQTLL 122 Score = 42.7 bits (99), Expect(2) = 2e-09 Identities = 20/63 (31%), Positives = 39/63 (61%) Frame = +1 Query: 280 NLWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFD 459 +L F+ L Y+ + R D++ ++ L + L E+RT + V+N L+++RRF+L +FD Sbjct: 147 SLGFDLLTQCYVQDKRVIDSVLIVRLMMENSLVPELRTLSTVLNGLIRIRRFDLVLQLFD 206 Query: 460 EGL 468 + + Sbjct: 207 KAV 209 >ref|XP_019150138.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Ipomoea nil] Length = 900 Score = 47.0 bits (110), Expect(2) = 2e-09 Identities = 23/61 (37%), Positives = 37/61 (60%) Frame = +1 Query: 280 NLWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFD 459 +L F+ LI +Y+ N + DA+ +L L L E RT V L+++RR+N+A ++FD Sbjct: 159 SLGFDLLIQSYVQNRKVLDAVLILRLMGECRLMAEFRTLGAVFGGLIRIRRYNIALSLFD 218 Query: 460 E 462 E Sbjct: 219 E 219 Score = 44.7 bits (104), Expect(2) = 2e-09 Identities = 27/65 (41%), Positives = 33/65 (50%), Gaps = 8/65 (12%) Frame = +3 Query: 63 RLNPSCRQRPCLHSC--------FINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFH 218 RL P +R LH+ F N+LGLH FH S SF ILV LV+ + W Sbjct: 70 RLKPRHIERVLLHTLDDSRLALRFFNFLGLHKNFHHSTASFCILVHALVQSNHFWPACSL 129 Query: 219 LQTLI 233 LQTL+ Sbjct: 130 LQTLL 134 >ref|XP_004295933.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Fragaria vesca subsp. vesca] Length = 910 Score = 48.1 bits (113), Expect(2) = 3e-09 Identities = 24/61 (39%), Positives = 37/61 (60%) Frame = +1 Query: 280 NLWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFD 459 +L F+ L+ Y+ N R D + V+ L +L EVRT N V+N L+++R FN+ +FD Sbjct: 162 SLGFDLLVQNYVQNKRVLDGVVVVRLMRECKLVPEVRTLNAVLNGLVRIRHFNVVLQLFD 221 Query: 460 E 462 E Sbjct: 222 E 222 Score = 43.1 bits (100), Expect(2) = 3e-09 Identities = 24/59 (40%), Positives = 31/59 (52%) Frame = +3 Query: 90 PCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAFK 266 P L F N+LGLH F+ S SF IL+ +LV+ L W LQTL+ E F+ Sbjct: 90 PRLALRFFNFLGLHKSFNHSTASFCILIHSLVQSSLFWPATSLLQTLLLRGSNPDEVFR 148 >ref|XP_021820348.1| putative pentatricopeptide repeat-containing protein At5g59900 [Prunus avium] Length = 904 Score = 46.6 bits (109), Expect(2) = 3e-09 Identities = 23/61 (37%), Positives = 36/61 (59%) Frame = +1 Query: 280 NLWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFD 459 +L F+ L+ Y+ N R D + V+ L E+ EVRT N ++N L++ R FN+ +FD Sbjct: 156 SLGFDLLVQNYVQNKRVLDGVVVVRLMRECEILAEVRTLNALLNGLVRFRHFNMVLQLFD 215 Query: 460 E 462 E Sbjct: 216 E 216 Score = 44.7 bits (104), Expect(2) = 3e-09 Identities = 24/59 (40%), Positives = 32/59 (54%) Frame = +3 Query: 90 PCLHSCFINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAFK 266 P L F N+LGLH F+ S SF IL+ LV+ +L W LQTL+ + E F+ Sbjct: 84 PRLALRFFNFLGLHKSFNHSTASFCILIHALVQSNLFWPASSLLQTLLLRGLNPNEVFQ 142 >ref|XP_019263026.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Nicotiana attenuata] ref|XP_019263027.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Nicotiana attenuata] ref|XP_019263028.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Nicotiana attenuata] gb|OIT37418.1| putative pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 891 Score = 48.1 bits (113), Expect(2) = 3e-09 Identities = 23/42 (54%), Positives = 28/42 (66%) Frame = +3 Query: 108 FINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLI 233 F N+LGLH FH SN SF ILV +LV+ L+W LQTL+ Sbjct: 81 FFNFLGLHKNFHHSNASFCILVHSLVQSSLYWPATSLLQTLL 122 Score = 42.7 bits (99), Expect(2) = 3e-09 Identities = 20/63 (31%), Positives = 39/63 (61%) Frame = +1 Query: 280 NLWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFD 459 +L F+ L Y+ + R D++ ++ L + L E+RT + V+N L+++RRF+L +FD Sbjct: 147 SLGFDLLTQCYVQDKRVIDSVLIVRLMMENSLVPELRTLSTVLNGLIRIRRFDLVLQLFD 206 Query: 460 EGL 468 + + Sbjct: 207 KAV 209 >ref|XP_015058255.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Solanum pennellii] ref|XP_015058256.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Solanum pennellii] ref|XP_015058257.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Solanum pennellii] Length = 891 Score = 46.6 bits (109), Expect(2) = 3e-09 Identities = 23/58 (39%), Positives = 36/58 (62%) Frame = +3 Query: 108 FINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAFK*NLIE 281 F N+LGLH F+ S +SF IL+ +LV+ +L+W LQTL+ ++ F NL++ Sbjct: 80 FFNFLGLHKNFYHSTMSFCILIHSLVQSNLYWPATSLLQTLLQRKVNPSFVFD-NLLD 136 Score = 44.3 bits (103), Expect(2) = 3e-09 Identities = 21/62 (33%), Positives = 38/62 (61%) Frame = +1 Query: 283 LWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFDE 462 L F+ LI Y+ + R D++ ++ L + L E++T + V+N L+++RRF+L +FD Sbjct: 147 LGFDLLIQNYVQDRRVMDSVLIVRLMMEHSLVPELKTLSSVLNGLIRIRRFDLVLQLFDN 206 Query: 463 GL 468 L Sbjct: 207 AL 208 >ref|XP_004251458.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Solanum lycopersicum] ref|XP_010313559.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Solanum lycopersicum] ref|XP_010313560.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Solanum lycopersicum] ref|XP_010313561.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 isoform X1 [Solanum lycopersicum] Length = 891 Score = 46.6 bits (109), Expect(2) = 3e-09 Identities = 23/58 (39%), Positives = 36/58 (62%) Frame = +3 Query: 108 FINYLGLHLCFHRSNLSFLILVQTLVKFHLHWATLFHLQTLISSQITSLEAFK*NLIE 281 F N+LGLH F+ S +SF IL+ +LV+ +L+W LQTL+ ++ F NL++ Sbjct: 80 FFNFLGLHKNFYHSTMSFCILIHSLVQSNLYWPATSLLQTLLQRKVNPSFVFD-NLLD 136 Score = 44.3 bits (103), Expect(2) = 3e-09 Identities = 21/62 (33%), Positives = 38/62 (61%) Frame = +1 Query: 283 LWFNFLILAYIHNNRDWDAIKVLNLAVGLELDMEVRTFNDVMNILMKVRRFNLATAVFDE 462 L F+ LI Y+ + R D++ ++ L + L E++T + V+N L+++RRF+L +FD Sbjct: 147 LGFDLLIQNYVQDRRVMDSVLIVRLMMEHSLVPELKTLSSVLNGLIRIRRFDLVLQLFDN 206 Query: 463 GL 468 L Sbjct: 207 AL 208