BLASTX nr result
ID: Ophiopogon23_contig00023425
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00023425 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAY70652.1| Protein IQ-DOMAIN 1 [Ananas comosus] 57 1e-06 ref|XP_020102271.1| protein IQ-DOMAIN 1-like [Ananas comosus] >g... 57 1e-06 >gb|OAY70652.1| Protein IQ-DOMAIN 1 [Ananas comosus] Length = 418 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 4/50 (8%) Frame = +1 Query: 16 ERGSVSSARKRLSFPVMAAPSVPA----ARRHSGPPKVDVAPLTSAGGNK 153 E+G+V SA+KRLSFP M P + + ARRHSGPPK+++A +TS G NK Sbjct: 369 EKGAVCSAKKRLSFPAMDKPGLTSPGKGARRHSGPPKLEIASITSNGENK 418 >ref|XP_020102271.1| protein IQ-DOMAIN 1-like [Ananas comosus] ref|XP_020102272.1| protein IQ-DOMAIN 1-like [Ananas comosus] Length = 468 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 4/50 (8%) Frame = +1 Query: 16 ERGSVSSARKRLSFPVMAAPSVPA----ARRHSGPPKVDVAPLTSAGGNK 153 E+G+V SA+KRLSFP M P + + ARRHSGPPK+++A +TS G NK Sbjct: 419 EKGAVCSAKKRLSFPAMDKPGLTSPGKGARRHSGPPKLEIASITSNGENK 468