BLASTX nr result
ID: Ophiopogon23_contig00023402
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00023402 (448 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFZ21182.1| hypothetical protein SINV_08535, partial [Solenop... 52 3e-06 ref|XP_011647682.1| PREDICTED: single-pass membrane and coiled-c... 52 5e-06 gb|KYN00928.1| hypothetical protein ALC62_08154, partial [Cyphom... 51 6e-06 ref|XP_019882439.1| PREDICTED: single-pass membrane and coiled-c... 51 8e-06 >gb|EFZ21182.1| hypothetical protein SINV_08535, partial [Solenopsis invicta] Length = 59 Score = 52.0 bits (123), Expect = 3e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 173 IFTIVLPTVVTMFLLIAAYVYFKTRPKSIEY 265 +FT+VLPTV MF++IAAYVY KTRPK +EY Sbjct: 29 VFTVVLPTVAAMFVIIAAYVYVKTRPKLLEY 59 >ref|XP_011647682.1| PREDICTED: single-pass membrane and coiled-coil domain-containing protein 4 homolog [Pogonomyrmex barbatus] Length = 66 Score = 51.6 bits (122), Expect = 5e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 173 IFTIVLPTVVTMFLLIAAYVYFKTRPKSIEY 265 +FT+VLPTV +F++IAAYVY KTRPK IEY Sbjct: 36 VFTVVLPTVAAIFVIIAAYVYIKTRPKLIEY 66 >gb|KYN00928.1| hypothetical protein ALC62_08154, partial [Cyphomyrmex costatus] Length = 60 Score = 51.2 bits (121), Expect = 6e-06 Identities = 20/31 (64%), Positives = 28/31 (90%) Frame = +2 Query: 173 IFTIVLPTVVTMFLLIAAYVYFKTRPKSIEY 265 +FT+VLPT+ +F++IAAY+YFKTRPK +EY Sbjct: 30 VFTVVLPTMAAIFVIIAAYIYFKTRPKLMEY 60 >ref|XP_019882439.1| PREDICTED: single-pass membrane and coiled-coil domain-containing protein 4 homolog [Camponotus floridanus] ref|XP_019882440.1| PREDICTED: single-pass membrane and coiled-coil domain-containing protein 4 homolog [Camponotus floridanus] ref|XP_019882441.1| PREDICTED: single-pass membrane and coiled-coil domain-containing protein 4 homolog [Camponotus floridanus] Length = 59 Score = 50.8 bits (120), Expect = 8e-06 Identities = 21/31 (67%), Positives = 27/31 (87%) Frame = +2 Query: 173 IFTIVLPTVVTMFLLIAAYVYFKTRPKSIEY 265 +FTIVLPT+ +F++IAAY+Y KTRPK IEY Sbjct: 29 VFTIVLPTIAAIFVIIAAYIYVKTRPKLIEY 59