BLASTX nr result
ID: Ophiopogon23_contig00023369
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00023369 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252465.1| uncharacterized protein At2g39795, mitochond... 62 4e-08 >ref|XP_020252465.1| uncharacterized protein At2g39795, mitochondrial-like [Asparagus officinalis] gb|ONK76888.1| uncharacterized protein A4U43_C02F890 [Asparagus officinalis] Length = 265 Score = 61.6 bits (148), Expect = 4e-08 Identities = 33/55 (60%), Positives = 39/55 (70%) Frame = +1 Query: 370 LRRGATDGLFFPKAAIGSRSDLSFFSPQRSNFSTLVAKPTSDAELVKVIESEIQC 534 L R +DG +A IGSR+DL F PQRS FS+L K SD+ELVKV+ESEIQC Sbjct: 26 LLRQTSDGRLLQRA-IGSRTDLGFSFPQRSQFSSLALKAASDSELVKVVESEIQC 79